KEGG   Fluviicola taffensis: Fluta_2052Help
Entry
Fluta_2052        CDS       T01455                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
fte  Fluviicola taffensis
Pathway
fte00521  Streptomycin biosynthesis
fte00523  Polyketide sugar unit biosynthesis
fte01130  Biosynthesis of antibiotics
Module
fte_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Fluta_2052
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Fluta_2052
Enzymes [BR:fte01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Fluta_2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AEA44038
UniProt: F2IKD5
Position
complement(2361291..2361839)
Genome map
AA seq 182 aa AA seqDB search
MEFKRTAIVDVLLIQPTIFGDDRGYFFESFHQQKFNEFIGAEINFVQDNESKSAKGVLRG
LHFQAPPHAQGKLVRVVQGSVLDVALDIRKNSPTYGQHVSFVLSAENKMQAYIPAGFAHG
FVTLEKDTIFQYKCTNWYNPSSEGSILWNDPALTIQWQEMNPILSDKDKLGILLADFNSP
FE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggaatttaaacgaacagcaattgttgatgtactactcattcaaccaaccatatttggt
gatgacagaggatacttcttcgaatcatttcatcaacaaaaattcaatgaatttataggt
gcagaaattaattttgtacaagacaatgaatcaaaatcagcaaaaggtgtgctcagagga
ttgcattttcaagccccaccccatgctcaaggtaagttagttcgagtagttcaaggcagt
gttctagatgttgcattggatattcgcaaaaactcacccacttatggtcaacatgtttca
tttgttttaagtgctgaaaacaaaatgcaagcttatattcccgctggttttgcacatggt
tttgtgaccttagaaaaggatactatttttcaatataaatgtaccaattggtataatcca
agcagtgaaggaagcatcctttggaatgatcctgcgttaactattcaatggcaagaaatg
aatcctatcttatcggataaagataagttgggaatattactcgccgattttaattctcca
tttgaatag

DBGET integrated database retrieval system