KEGG   Fluviicola taffensis: Fluta_2078Help
Entry
Fluta_2078        CDS       T01455                                 

Definition
cysteine desulfurase (EC:2.8.1.7 4.4.1.16)
Orthology
K11717  
cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
fte  Fluviicola taffensis
Pathway
Selenocompound metabolism
Thiamine metabolism
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:fte00450]
Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism [PATH:fte00730]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2399609..2400844)
Genome map
AA seq 411 aa AA seqDB search
MENATTRKMSVREIRQDFPALRQQVYGKNLIYFDNGATSQKPQMVLDAINQYYSMDNANI
HRGVHHLSQKATSEYEEARETIRRFINAEKKDEIIFTKGTTDGINLVASSFGELLSAGDE
IIISAMEHHSNIVPWQMLAERKKLVLKVIPINKRGELLLEDYQNMLSSKTKLVAITHISN
SLGTINPVEQIIESAHAVGAKVLIDGAQSVQHTKVDVQAMNCDFFVFSGHKVFGPTGIGV
LYGKEALLDEMPPYQGGGDMISKVTFERTTYNELPFKFEAGTPHIAGGICLGTALNYLNQ
FDSKELEEYERDLTEYAQEMLETFENITLIGTAKNKTSVVSFHIPGIHPFDIGTLLDKQG
IAVRTGHHCTQPLMDFYQIPGTIRASFAFYNTREEIDAFIAAVEKSISMLG
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgcaacaacaagaaaaatgagtgtgcgagagatccgccaagatttcccagct
ttgcgtcagcaggtttatggaaagaacctgatttattttgacaatggcgcaacatctcag
aaaccgcaaatggtattggatgcaattaaccagtattacagcatggacaatgcgaatatt
catcgcggcgttcatcatttaagtcaaaaagcaacttctgaatacgaagaggcacgagaa
acgattcgccgttttatcaatgctgaaaagaaagatgaaattattttcacgaaaggaacc
acagacggaatcaatctggttgcaagttcattcggtgaattattgagtgctggcgatgaa
attattatttctgccatggaacaccactcaaacattgttccgtggcaaatgcttgcagaa
cgcaaaaaattagttttaaaagtcattcccatcaataaacgaggcgaattgcttttggaa
gattatcaaaacatgctttcttccaaaacaaaattggtagcaatcacgcatatttcaaat
agtttaggaaccattaatccagttgaacaaatcattgaaagtgctcatgcggttggggca
aaagtgctaattgatggtgctcaaagtgtgcaacataccaaagtggatgttcaggcaatg
aattgcgacttttttgtcttttcaggccataaagtttttggtccaacaggaattggagtt
ctttatggaaaagaagcgcttttggatgaaatgcctccgtaccaaggtggtggagatatg
atttcgaaggtgacttttgagcgaacaacatataacgaactacccttcaaatttgaggcg
ggaacaccacatattgcaggaggaatttgtttgggaaccgctttgaactacttgaatcaa
tttgattccaaagaattggaagaatacgaacgcgacttgactgaatatgcgcaagaaatg
ttggaaacctttgaaaacattaccttgattggaactgccaaaaacaaaacttcagtcgtt
tctttccatattcctgggattcatccttttgacatcggaaccttattagacaagcaagga
attgctgtaagaactggccatcattgcacacaaccattgatggatttttatcaaatacct
ggaacgattagagcttcctttgctttttacaatacacgagaagaaatagacgcatttata
gcagccgtggaaaaaagtatttccatgctgggttaa

DBGET integrated database retrieval system