KEGG   Fluviicola taffensis: Fluta_2119Help
Entry
Fluta_2119        CDS       T01455                                 

Definition
Acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
fte  Fluviicola taffensis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:fte00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2445852..2446391
Genome map
AA seq 179 aa AA seqDB search
MAILSIPDLNKTIHDVSEIRHFLNTRGIFFDQWQADVVFEDSANQEEILKAYESSLTPFM
NSGGYQTADVITINKLTENYEAIRNKFLAEHTHSEDEIRFFVDGEGLFWFNLENEPVFNL
LCEKGDLISVPEGTKHWFDAGETNPFVKAIRIFIDMSGWIPDYTGSGLEGRFAEFRVER
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcgatattatctattccagatctgaacaaaacgattcacgacgtaagcgaaattaga
cattttttgaacacccgcggaatcttttttgatcaatggcaagcagatgttgtatttgaa
gatagcgccaatcaagaagaaattctaaaagcttatgaatctagtttgactccatttatg
aattcaggtggttatcaaacggcggacgtaattacaatcaataaattgaccgaaaattac
gaagctattcgtaataaattcttagcagaacacacacattctgaagatgaaattcgattt
tttgtggatggagaaggattgttttggttcaatttagaaaatgaaccagttttcaatcta
ctttgtgaaaaaggagatttgatttccgttcccgaaggcacaaaacattggtttgatgca
ggagaaacaaatccgtttgtgaaagcaattcgcattttcattgatatgagtggttggatc
ccagattatacaggctcaggattagaaggacgatttgctgaatttcgagtagaaagataa

DBGET integrated database retrieval system