KEGG   Fluviicola taffensis: Fluta_2119Help
Entry
Fluta_2119        CDS       T01455                                 

Definition
Acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
fte  Fluviicola taffensis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Fluta_2119
Enzymes [BR:fte01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Fluta_2119
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Fluta_2119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2445852..2446391
Genome map
AA seq 179 aa AA seqDB search
MAILSIPDLNKTIHDVSEIRHFLNTRGIFFDQWQADVVFEDSANQEEILKAYESSLTPFM
NSGGYQTADVITINKLTENYEAIRNKFLAEHTHSEDEIRFFVDGEGLFWFNLENEPVFNL
LCEKGDLISVPEGTKHWFDAGETNPFVKAIRIFIDMSGWIPDYTGSGLEGRFAEFRVER
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcgatattatctattccagatctgaacaaaacgattcacgacgtaagcgaaattaga
cattttttgaacacccgcggaatcttttttgatcaatggcaagcagatgttgtatttgaa
gatagcgccaatcaagaagaaattctaaaagcttatgaatctagtttgactccatttatg
aattcaggtggttatcaaacggcggacgtaattacaatcaataaattgaccgaaaattac
gaagctattcgtaataaattcttagcagaacacacacattctgaagatgaaattcgattt
tttgtggatggagaaggattgttttggttcaatttagaaaatgaaccagttttcaatcta
ctttgtgaaaaaggagatttgatttccgttcccgaaggcacaaaacattggtttgatgca
ggagaaacaaatccgtttgtgaaagcaattcgcattttcattgatatgagtggttggatc
ccagattatacaggctcaggattagaaggacgatttgctgaatttcgagtagaaagataa

DBGET integrated database retrieval system