KEGG   Fluviicola taffensis: Fluta_2495Help
Entry
Fluta_2495        CDS       T01455                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fte  Fluviicola taffensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fluta_2495
   01230 Biosynthesis of amino acids
    Fluta_2495
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fluta_2495
   00030 Pentose phosphate pathway
    Fluta_2495
   00051 Fructose and mannose metabolism
    Fluta_2495
   00052 Galactose metabolism
    Fluta_2495
  Energy metabolism
   00680 Methane metabolism
    Fluta_2495
Enzymes [BR:fte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Fluta_2495
Protein phosphatases and associated proteins [BR:fte01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Fluta_2495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2874636..2875619
Genome map
AA seq 327 aa AA seqDB search
MSELKRIGVLTSGGDSPGMNACIRAVVKAGIGKGIQVFGIEDGYKGMIEDRIRELTYTDV
NNIIHLGGTILGTARSEEFKLKEWREKAVANLRKLQIEALILIGGDGTFAGGMTLTNEFD
IPIIGIPGTIDNDIHGTEFTIGYDTCLNTVVEAVDKIRDTASSHHRVFFIEVMGRASGYI
ALNTAIASGAESVLIPETVTDIPLLADQIRNQNKGIRSSIIIVAEGDEEGGAKEIMKKVK
PYLETYDLKCSILGHIQRGGSPSAFDRILATRMGVKAVELLFEGKKSMMIGQIGRDLVFH
NILEGTTDHVSKDDSGIGLLKLLLTKG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctgaaaagaattggagttttgacttctggtggagattcaccaggaatgaat
gcgtgtattcgtgcagtggtgaaagctggaatcggaaaagggatacaggtatttgggatt
gaagatggatataaaggaatgattgaggatcgaattcgagaattaacctatacagacgtt
aataatatcattcatttgggaggtacaatcttaggaactgcaaggagtgaggaattcaaa
ttgaaggaatggcgagaaaaagcagttgctaatttaagaaaactccaaatcgaagcactt
atattaataggtggtgatggaacttttgctggaggaatgacattaacgaatgaattcgat
attcctattataggtattcctggtacaatagataatgatatccacggcacagaatttacg
ataggttatgatacttgtttgaatacagttgtagaggcggtggataaaattagagatact
gcttcaagccatcatcgagtgtttttcattgaagtaatgggaagagcttctggttatatc
gcattgaatacggcaattgctagtggagctgagtcagtactaattccagaaacagttacg
gacattcctttattggcagatcaaatccgaaatcaaaataaaggaatccgaagttctatt
attatagttgctgaaggcgatgaagagggaggtgcaaaagaaatcatgaaaaaggtaaag
ccttatcttgaaacttatgatttgaagtgttccattcttggacatatccaacgtggtggg
agtccatctgctttcgaccgaattcttgcaacaagaatgggggtaaaggcagttgaatta
ctttttgaaggaaaaaaatcaatgatgatcggtcaaattggaagagatttagtctttcac
aatatattagagggaacaacagatcacgtttcaaaagacgactcaggcattggattactc
aaattgttactgacaaaggggtag

DBGET integrated database retrieval system