KEGG   Fluviicola taffensis: Fluta_2507Help
Entry
Fluta_2507        CDS       T01455                                 

Definition
Peroxiredoxin (EC:1.11.1.12 1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fte  Fluviicola taffensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Fluta_2507
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Fluta_2507
Enzymes [BR:fte01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Fluta_2507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2893463..2893996)
Genome map
AA seq 177 aa AA seqDB search
MKTILISLLVLISIIGNSQTIYDFKVTDIDGKEFDLASLKGKKIMIVNTASKCGLTPQYE
ELEKLYNTYKDSNFVIVGFPSNDFMSQEPGSNDEIKEFCKKNYGVSFPMMSKIDVKGKTM
HPLYVFLTEKSKNGVSDNSVKWNFQKYLINEEGKLVKVISPSTKPLSEEIVSWIVNK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatattgatttctttattggttctaattagcattattggtaatagtcaaact
atatacgattttaaagttactgatattgatggcaaggaatttgatttggcatctttaaaa
ggaaaaaaaattatgatcgtgaatactgcatctaaatgtggattaacgcctcaatatgaa
gaattggaaaaactatacaatacttacaaagacagcaactttgtcattgtaggtttcccc
tctaatgattttatgtctcaggagcctggttcaaatgatgaaattaaggagttttgtaaa
aagaattacggtgttagttttccaatgatgagcaaaattgacgtgaaaggaaaaacaatg
catccattgtatgtgtttttaacagaaaaatctaaaaatggagtttcagataattctgtt
aaatggaattttcaaaaatacttaatcaatgaggaaggcaaattggttaaagtaatatcg
ccttcaacaaaaccgctttctgaagagattgtgtcctggattgtaaacaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system