KEGG   Fluviicola taffensis: Fluta_2618Help
Entry
Fluta_2618        CDS       T01455                                 

Definition
Mg-chelatase subunit ChlI-like protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
fte  Fluviicola taffensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Fluta_2618
Enzymes [BR:fte01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Fluta_2618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3018177..3019640)
Genome map
AA seq 487 aa AA seqDB search
MKKINTLGELKASGYQTKSVKEELRSNLMEALKTGKQPFEGIHGYENTVIPELERAILAK
HNINLLGLRGQAKTRLARLMVNLLDEWMPIIQGSEVNDDPLAPLSRYAKDLIAEKGDETP
ISWVHRDERFAEKLATPDVTIADLIGDVDPIKAANMKLSYADERVIHFGMIPRANRCIFV
INELPDLQARIQVALFNILQEGDIQIRGFQLRFPLDIQFVFTANPEDYTNRGSIVTPLKD
RIGSQILTHYPETIQIARAITEQEAKLEGDQKENISVPGLAMDIIEQIGFEARESEYIDV
KSGVSARMSISAFENLVSAAELRGLKSKNLKTSVRLADFTGIIPALTGKMELVYEGEQEG
SYYVAEQLIGRAVKTLFESYFPKVEKLEKPGEGGPYQEIVDWFFEQDEFVLSDDADDKTY
HAQLDAITPLETLIQKYQPKVLTNEKHFLKEFVLWGLVESKKLSKSELENGTTFSDQFSS
YVRGGLN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcaacacattaggcgaattaaaggcatcaggataccaaacaaaaagcgtt
aaggaagaattgcgttccaacttaatggaggcattgaaaacagggaaacaaccctttgaa
ggtattcacggatatgaaaatacagttatccctgaactggaacgtgcgattttagcaaaa
cacaacatcaatctattgggattgcgcggtcaggcaaaaacccgattagcgcgcttgatg
gtcaatttattggacgaatggatgccgattattcagggttcggaagttaacgatgatcct
ttggcgccactttcacgctatgcgaaggatttgattgctgaaaaaggagatgaaacacca
atctcttgggttcacagagatgaacgctttgcagaaaaattagcaactccagatgttact
attgctgacctcatcggagatgtagatccaatcaaagcagcgaatatgaaattgtcgtat
gcagacgagcgtgtgatccatttcggaatgattccgcgtgcaaaccgttgtattttcgtc
attaacgaattacccgatctacaagctagaatccaggttgccttgttcaatattctacag
gaaggagatattcaaattcgtggattccaattgcggttcccactagatattcaatttgta
tttacagcaaatccagaagattacaccaatcgcggaagtattgtaacgcctttgaaagac
agaattggttctcaaattttaacgcattaccctgaaacgattcaaattgcacgagcaatc
acagaacaagaagcaaaattggaaggtgatcaaaaagaaaatatttccgttccaggtttg
gcaatggatatcatcgaacaaattggattcgaagcacgtgaaagtgaatacatcgatgtg
aaaagtggagtaagcgctcgtatgagtatttctgcttttgaaaacttggtgagtgcagcc
gaattacgcggattgaaaagtaaaaatctaaaaacaagtgttcgtttagctgatttcact
ggaattatccctgcattaactgggaaaatggaattggtgtacgaaggtgaacaagaagga
agctactatgtcgctgaacaattgattggaagagccgtaaaaaccttatttgaaagctat
ttcccgaaagtggaaaaattagaaaaaccaggagaaggtggtccataccaagaaatcgta
gattggttcttcgagcaagatgagtttgttctttcagacgacgcagatgataagacctat
cacgcacaattagacgcgattactcctttagaaacgttgattcagaaataccaaccgaaa
gtacttacaaacgagaagcatttcttgaaagaatttgttttgtggggattggttgaaagt
aaaaaactaagcaaatcagaacttgaaaacggaacaacttttagtgatcaatttagctct
tatgtaagaggtggattgaattaa

DBGET integrated database retrieval system