KEGG   Fluviicola taffensis: Fluta_2651Help
Entry
Fluta_2651        CDS       T01455                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fte  Fluviicola taffensis
Pathway
fte00020  Citrate cycle (TCA cycle)
fte00310  Lysine degradation
fte01100  Metabolic pathways
fte01110  Biosynthesis of secondary metabolites
fte01120  Microbial metabolism in diverse environments
fte01130  Biosynthesis of antibiotics
fte01200  Carbon metabolism
Module
fte_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fte_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fluta_2651
  Amino acid metabolism
   00310 Lysine degradation
    Fluta_2651
Enzymes [BR:fte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Fluta_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding VHS
Motif
Other DBs
NCBI-ProteinID: AEA44632
UniProt: F2IFE7
Position
complement(3051994..3053346)
Genome map
AA seq 450 aa AA seqDB search
MAQIEIRLPKMGESVTEATITNWLKEVGDTVEMDEPLVEVATDKVDNELPSEAAGVLVQK
LFEKDQVAQVGDVIAIISTDGDAAPVAPKADNAAVAAVAETVAVAQAVVSNGGVTLEKSS
GNGKFISPLVRSIAQQENISMSEIDALSGTGMGGRVTKKDILSYIDTRGTAPAAVAQPPV
SVAAPAASNGAAPAVVSGGNSFLSNIKEPVVVPMPGDEIIEMDRMRKLIAEHMVMSKHVS
PHVTSFVEADVTNIVMWRNKMKKDFEKREGENLTFTPIFMEAIVKAIKDFPMINVSLSGN
QIIKRKDINIGMATALPSGNLIVPVIKNADRLNLTGIAKSVNQLARAARDNKLKPEDIQG
GTYTVTNVGTFGNVMGTPIINQPQVAILALGAIRKLPAVIETPEGDFIGIRHKMFLSHSY
DHRVVDGSLGGMFVRRVADYLEQFDVNREL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaattgaaattcgtcttccaaaaatgggagaaagcgttacagaagctaccatt
accaattggttaaaagaagttggtgacacggttgaaatggatgaacctttggtagaagtt
gcaacggataaagttgataacgaattaccatcagaagctgctggagttttggttcaaaaa
ttatttgaaaaagatcaagttgctcaagttggtgatgtaattgcgattatatctactgat
ggagatgctgcacctgttgctccaaaagctgacaatgcagctgtagcggctgttgctgaa
acggttgctgttgctcaagcagtagtttcaaatggtggagttactttagaaaaaagtagt
ggaaatggaaaattcatttctccgcttgttcgaagtatcgcacaacaagaaaatatttcc
atgtcagaaattgatgcacttagcggaactggcatgggtggaagagtgactaaaaaagac
attctttcatacattgatacaagaggaacagctcctgctgctgtagctcaaccaccagta
agcgttgctgccccagctgcgtcaaatggtgctgctccagctgttgtttcaggaggaaat
tcattcttgagtaacatcaaagaaccagttgtggttcctatgcctggagatgaaatcatt
gagatggatcgtatgcgtaagctaattgctgagcacatggtgatgtctaagcatgtttcc
cctcacgttacttcattcgttgaggctgacgttacaaatatcgttatgtggagaaataaa
atgaaaaaggattttgaaaaacgcgaaggtgaaaacctaacgttcactcctattttcatg
gaagcaattgtgaaagcaatcaaagatttcccaatgatcaacgtttctttatccggaaat
caaatcatcaaacgcaaggatatcaatattggaatggcaactgcacttccttctggaaac
ttaattgttccagttattaagaacgctgatcgtttgaacttaacaggtattgcaaagtcg
gtcaaccaattagcaagggctgcacgcgataacaaattgaaaccagaagatattcaaggt
ggaacatatacagtaacaaacgttggaacatttggaaacgtaatgggaactcctattatc
aaccaaccacaagttgcgattcttgcattaggtgcgattcgtaaattaccagcagttatt
gaaacacctgaaggagattttatcggtattcgtcacaaaatgttcttgtcccactcctat
gaccaccgagtggttgatggatcattgggaggaatgtttgtaagaagagttgctgactat
ttagagcagtttgatgtcaatagagaactctaa

DBGET integrated database retrieval system