KEGG   Fluviicola taffensis: Fluta_2820Help
Entry
Fluta_2820        CDS       T01455                                 

Definition
Cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fte  Fluviicola taffensis
Brite
Enzymes [BR:fte01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Fluta_2820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3244620..3245660
Genome map
AA seq 346 aa AA seqDB search
MKKVEYACLLLFTLIMSSFLFVKIFEFPASWPKPIYDFKKNPLDESKIELGRALFYDPIL
SLDSSISCASCHSSYVAFTHVDHKLSHGISDRIGTRNTPALMNLAWQTTFMWDGAVNHLD
MQALAPISHSDEMGSDIKVVVQKLQRVPFYQHLFEKAYGTDKITGERVLKSLSQFMLTLV
SCNSKYDKVKRNEAAFSDQENRGYSLFKQHCAGCHSEPLFTSHKFANNGLTIDTSLNDLG
RMKQTGSSSDSLCFKIPTLRNAEYSFPYMHDGRFKKLSEVLNHYDSGIQSSKSLAKELQK
SFHLTSQNKVDLIAFLLTLSDRDFVMNQKSAYPKELFSTRAKESIK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggtagaatatgcttgtttacttctttttactcttattatgagttcctttctc
tttgtgaagatttttgagtttccagcatcttggccaaaacctatttatgattttaaaaaa
aatccgctggatgaatcgaaaattgaattgggaagagcattattttacgatccgatttta
tctctagacagcagtatttcctgtgcgagttgtcattcttcttatgttgccttcacgcat
gtggatcacaaactgagtcatggaatctctgatcggattggaacgagaaatacccctgcg
ttgatgaatttagcttggcaaacaaccttcatgtgggacggagcagtgaatcatttggat
atgcaggcgcttgctccaattagtcattcagatgaaatgggaagtgacattaaagtggtt
gtgcaaaaacttcagcgagtaccattttatcagcatttgtttgaaaaagcttacggaacg
gataaaattactggagagcgggtcttaaaatcactttcgcagtttatgttgacgctcgtc
agttgcaattcgaaatacgataaagtgaagcggaatgaagctgctttttcagatcaagag
aaccgcggttacagtttattcaagcaacattgtgctggttgtcattcagaacctcttttc
acaagccataaatttgcgaataatgggttgacgattgacacatctttgaatgatttggga
agaatgaagcaaactggaagttcatcagattccttgtgttttaaaattccaactttaaga
aacgcagaatactcattcccatacatgcatgatgggcgtttcaagaaactttcagaagta
ttaaatcactacgattcaggtatacaatcatccaaaagtttagcaaaagagcttcagaaa
agtttccatttaacttctcaaaacaaagtagatttgattgcttttttacttacactttct
gatcgggattttgtcatgaatcaaaaaagtgcctatccgaaagaactattttctacccga
gcgaaggaatcgattaaatag

DBGET integrated database retrieval system