KEGG   Fluviicola taffensis: Fluta_2854Help
Entry
Fluta_2854        CDS       T01455                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fte  Fluviicola taffensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:fte00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:fte00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3285157..3285621
Genome map
AA seq 154 aa AA seqDB search
MILYDFSLNQLNGNPIDWNDFQGKKVLLVNVASQCGLTPQYTQLQELQEEFGGNDFAVLG
VPCNDFAGQEPGTSEEIAVFCSTNYGVSFPLSEKVHTVGEEIHPIYKWLKDETGADVTWN
FQKFLIDEEGKVTGFYSPQTEPADSHILDWIKKS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgatattgtatgatttttccctgaatcagttgaatggaaatccaattgattggaatgac
tttcaaggaaagaaagttcttttggtaaatgttgcttcgcaatgtggtttaactcctcag
tatacacaattacaagagttacaagaagagtttggtggaaatgacttcgcggtattggga
gttccttgtaatgattttgcaggacaagagcctggaacttctgaggaaatcgctgtattt
tgttctacaaattatggtgtgagttttccactttctgaaaaagtacatacggttggagaa
gagattcacccgatttataaatggttgaaagatgaaactggggcagatgtgacttggaat
tttcagaagtttttgattgatgaggaaggaaaagtgactggtttttattctccacaaacg
gaacctgctgattcgcacattttagactggatcaagaaatcatga

DBGET integrated database retrieval system