KEGG   Fluviicola taffensis: Fluta_3166Help
Entry
Fluta_3166        CDS       T01455                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
fte  Fluviicola taffensis
Pathway
fte00790  Folate biosynthesis
fte01100  Metabolic pathways
Module
fte_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fluta_3166
Enzymes [BR:fte01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Fluta_3166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind S-AdoMet_synt_C
Motif
Other DBs
NCBI-ProteinID: AEA45140
UniProt: F2I9F9
Position
complement(3634264..3635145)
Genome map
AA seq 293 aa AA seqDB search
MEFLRSENTNFSREWALNIRGKLFTISTPQVMGIVNCTPDSFYASSRKSSIDSQKSLIDL
HVENGATWLDIGGYSTRPGAEHISETDEIERIKQAVSYALEKYSTVKISVDTFQSEVANY
VLEQGVHLINDISGGLINEELFSIIASHEVPYVLMHMRGTPQNMTQLNSYENMLQEILIE
LGIQVEKARKAGIKDIIIDPGFGFAKNSEQNLELFSRLEAFQLFDSPILIGISRKSLISK
TLGIDSFDSLNGTTVLNTLALEKGANILRVHDVKEAVETVKLWSKIKGIPSPE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggaatttttaaggtctgaaaatacaaatttttcgcgagaatgggcgttaaacatccgt
ggtaagttattcactatttccactccacaggtgatgggaatagtgaattgcacacctgat
tcgttctatgcgtctagcagaaagtcttcgattgattctcaaaagagtttgattgattta
cacgttgaaaatggcgcaacttggttagatataggtggttactctacccgaccaggagcc
gaacacatttctgaaaccgatgaaattgaacgcatcaaacaagctgtttcttatgcttta
gagaagtattcaaccgttaaaataagtgttgatacttttcaatctgaagtagcaaattat
gtgctagaacagggtgttcatctcattaatgacatcagtggcggactaatcaacgaagaa
ctattttcaattatagcaagccatgaagttccttatgtattgatgcacatgcggggaact
cctcaaaatatgacacaactcaactcatacgagaacatgcttcaagaaatactgattgag
ttaggaattcaagttgaaaaagcccgtaaagctggaataaaggatataatcattgaccca
ggatttgggtttgcaaagaatagcgaacaaaatttagaattgttttctagactagaagct
ttccagctatttgactctccaatcttaattggaatttctcgaaaatcgttgatctctaaa
acattgggaattgattcttttgattcgctaaacggaacaactgttttgaatacacttgct
ttggaaaaaggagcaaacattcttcgggtacatgatgtgaaagaagcagttgagacggtg
aaactgtggtcaaagataaaaggaataccatcccccgaataa

DBGET integrated database retrieval system