KEGG   Fluviicola taffensis: Fluta_3176Help
Entry
Fluta_3176        CDS       T01455                                 

Definition
Cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fte  Fluviicola taffensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3652523..3653554)
Genome map
AA seq 343 aa AA seqDB search
MNSSLVFKLLIALSIGSLIVSCKKAKVEPYKPWGFNSPSYFPTPTYTFENNKQTYQKFVL
GRALFYETMLSSDQTISCATCHANTHGFAGHNTALSAGVSGLLGTRNSPSIANLAWSTSF
MWDGGINHIEIMPVAPLTNPVEMNETFSSIISKLQTSDKYKKLFMDAYGNEDITEQKILK
ALTQFMMMIISDNSKYDRVRRGEDSFTAYEQEGYELFQQKCSQCHTEPLFTDHSFRNNGL
EINAFNDEGRFLITQNEEDKGKFKVPSLRNVVMTYPYMHDGRFYTLSAVLDHYSSGVHQS
ATLDPSLQSGIALTGAEKSRIIDFLKTLNDYELTSSSWLAEPK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaatagttcattggtatttaagctgctgattgcattgtcaatcggcagcttaatcgtt
tcgtgtaaaaaagcaaaggttgagccgtataagccttggggatttaattctccaagttac
tttcctacccctacttacacgttcgaaaacaacaaacaaacgtatcagaaatttgttttg
ggaagagccttattttacgaaacgatgctgtcttccgatcaaacaatttcatgtgctaca
tgtcatgcgaacacacatggttttgctggacacaatacagctttaagtgcgggagtaagc
ggattactcggaacacggaattcaccctcaatagccaacttagcatggtcaacttctttt
atgtgggatggtggcatcaatcacattgaaattatgcctgtcgctcctctaacaaatcct
gttgaaatgaatgaaactttttcaagtatcatttcgaaattacagacttctgataaatac
aaaaagttgtttatggatgcttatggaaatgaagatataacagaacaaaagattttgaaa
gcacttacacagtttatgatgatgattatctcggataattcaaagtatgatcgagtaaga
agaggtgaagatagttttacagcctacgaacaagaagggtacgaactttttcagcaaaaa
tgcagtcagtgtcatactgaacctctgtttacagatcattcgttcagaaacaatggacta
gagatcaatgcattcaatgatgaaggccgatttctgattactcagaatgaagaagacaaa
ggcaagttcaaagtccctagtttaagaaatgtagttatgacctatccgtatatgcacgat
ggtcggttttataccctaagtgccgtactcgatcattatagcagtggagttcaccaatcg
gcaacactagacccttctctgcaaagcggaattgctttaacgggtgcagaaaaaagtaga
atcatcgattttttgaaaacgttgaatgactatgaattgactagtagcagttggttagct
gagccgaaataa

DBGET integrated database retrieval system