KEGG   Fluviicola taffensis: Fluta_3375Help
Entry
Fluta_3375        CDS       T01455                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fte  Fluviicola taffensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fluta_3375
DNA repair and recombination proteins [BR:fte03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Fluta_3375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3880277..3880882)
Genome map
AA seq 201 aa AA seqDB search
MNIPSKYVEEAVEQFSSLPGIGKRTALRLVLNLLKRNPEELERFGDVLQQLKTHVQSCSS
CGNISDTAICSICANEKRNHRLICVVEDIRDVMAIESTGTYLGIYHVLGGIISPMDGIGP
NDLFIQPLVDKCSQGSVDEIILALSPTMEGDTTNFFLYKKIHATNVQITTLSRGIAVGSE
IQYADEITLSRSIQQRIPFQS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaatattccttcaaaatatgtagaagaagcagttgaacaattcagctcattaccagga
attggaaaacgtactgcattgcgcttggttttgaatttattaaaaaggaatccggaagaa
ttggagcgctttggggatgttttacaacaattaaagactcatgtacaaagttgttcttct
tgcggaaacatttccgataccgctatttgctctatctgtgctaatgagaagcgaaatcat
cgcttaatttgtgttgtagaggatattcgtgatgtaatggcgattgaaagcactggaact
tacttggggatttatcatgtcttaggaggcattatttcaccgatggatggaattggtccg
aatgatttatttattcaaccattggtagataaatgttcgcaaggttctgtggatgaaatc
atcttagcacttagtccaaccatggaaggcgataccacaaacttcttcttgtacaaaaaa
attcatgcaacaaacgttcaaatcacgaccctttctcgcggaattgcagtaggttcagaa
attcaatacgcggatgaaattaccttgtcgcgatcaattcagcaacgcattccgtttcaa
tcataa

DBGET integrated database retrieval system