KEGG   Fluviicola taffensis: Fluta_3394Help
Entry
Fluta_3394        CDS       T01455                                 

Definition
Cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fte  Fluviicola taffensis
Brite
Enzymes [BR:fte01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Fluta_3394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3900220..3901194
Genome map
AA seq 324 aa AA seqDB search
MKFNKQGILICFLLILLGSMCTFRKKNTLILGEIPSPIDNLNSSEKIAFGKMLFFDKRLS
KNNEIACSNCHQPEKAFTDGLPKSIGIEGRVAMRNAPSLLNSAYFKSYMYDGEVKTLELQ
ALVPMQDHQEMGSSMKEILQKLSNDEQYSQLAKSIFKRELDAFVITRALSSYERSLISQN
SKFDRYRAGENAVLNSDELAGWLLFSEKLYCTKCHSAPHFTNYKVLSNGLYSDYVLDNGR
FRINGLQTDNGKFKVPSLRNVALTAPYMHDGSIETLRGVILHYSKGGEVFENKSPIIRPF
SITEHEISQLEQFLRTLTDTSGIN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaataagcaaggcattttaatctgtttcctattgattctattaggatcaatg
tgtactttccgcaagaaaaacaccttgattttgggtgaaattccctctccaattgacaat
ctaaattcaagtgagaaaattgcttttgggaaaatgctcttctttgataagagactctcc
aaaaacaatgaaatagcttgttccaactgtcatcagcctgagaaagcttttacagatggt
ttacccaagagtattggtattgaaggaagagttgcgatgcgcaatgctccaagtttattg
aacagcgcttattttaaaagctacatgtatgatggcgaagtaaaaacgttagagctccaa
gcattggtccctatgcaagatcatcaggaaatggggagttcgatgaaggaaattcttcaa
aagctttctaatgatgagcaatacagccaattagcaaaatctatttttaaacgagagtta
gatgcatttgtcattacacgtgcattaagttcttacgaaagatctttaatcagccagaat
agtaaatttgaccgctatcgagcaggggagaatgcggttttaaattcagatgaactagca
ggttggcttttgttttctgaaaagctgtattgtacgaaatgtcattcagctcctcatttc
accaattacaaagtactcagcaatgggttgtattctgattatgtattggataatggtcgt
tttcgaataaatggcttgcaaactgataatggaaaatttaaagttcctagtttgcgaaat
gtagccttaacagctccttatatgcacgatggaagtattgagactttgcgaggtgttatt
ttgcattattccaagggaggtgaggtatttgaaaataaatcccctattattcgaccattt
tcgattactgaacatgaaatcagtcaattggaacagtttttaagaactctaactgacact
tctggaatcaattag

DBGET integrated database retrieval system