KEGG   Fluviicola taffensis: Fluta_3552Help
Entry
Fluta_3552        CDS       T01455                                 

Definition
Histidinol-phosphate aminotransferase (EC:1.1.1.23 2.6.1.9)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
fte  Fluviicola taffensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fluta_3552
  Amino acid metabolism
   00340 Histidine metabolism
    Fluta_3552
Enzymes [BR:fte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Fluta_3552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4056330..4058663)
Genome map
AA seq 777 aa AA seqDB search
MKVLINPSQLELTLALNRPKLESTNLESIISDIFTQVESDKDKALKALTLQFDQVSITDL
AVSKPEFDEANQLVSFELKEAIQVAAQNIERFHRSQENKEYEVETSPGVVCWRKSLPIQR
VGLYVPGGTAPLFSTVLMLGIPAKIAGSSIRYLCTPPNREGKIHPAILFAAKMAGIETVY
KVGGAQAIAAMSFGTESIPKADKIFGPGNQYVTAAKQYAQRLGIAIDMPAGPSEVLVAAD
NSIPASFVAADLLAQAEHGTDSQVIFLSDQILFVDEVLTEIEKQLAILPRAGIAREAMKA
STAIVVEAENWSEIINSYAPEHLIIMGKYEELVLKKVINAGSVFIGKNTAESFGDYASGT
NHTLPTSGFARSYSGVSLDSFVKKITYQKVSDEGIRNLAQTVITMAEAEELQGHANAVKV
RLEYASSIREQQTSDSVSKIQTFIRNDFRDVKSYSSARDEFEGLGEVFLDANENGLVTAY
NRYPDPLQFELKSEISIAKNVPSENIFLGNGSDEVLDLIFRLTATPFLDSAAYLNPSYGM
YPVLAKVNGVRTIPINLDSKFNISVSEILSQANGSKLLVICNPNNPTGGIICKTKILEIV
KEFNGVVVIDEAYIDFCTSNSVVDEVNNYPNLIVVQTLSKAYGMAGLRIGMAIASSEWIT
ALNSIKPPYNLSSLVQKTAINELKSINWKAIKTGIINERERLISFLKSNKKVIEVFPTEA
NFILFRIPNATEIYNKLIKKGVIVRNRSTQYNCADTLRVSVGTKIENDKFIQMMQKL
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcctgataaatcccagtcagttggaactaacacttgcactgaatcgtccaaag
ttagaatccacgaatcttgaatccataatttcggatatttttactcaggttgaatccgac
aaggacaaagcgttgaaagcattgacacttcaatttgatcaggtttcaattactgattta
gcagtttctaaacctgaatttgatgaagccaatcaattggtttcatttgagttgaaagaa
gccattcaagttgcagctcaaaatattgaacgttttcatcgatctcaggaaaacaaggag
tatgaagtagaaacctctccaggagtggtttgttggagaaaatccctccccattcaacga
gttggtttgtatgttccaggaggaaccgcgcctttgttttcgacggttttaatgcttgga
attcctgctaaaattgcaggaagtagcatcagatatttgtgtactcctccaaatagagaa
ggaaaaatccatcctgcgattttatttgcagctaaaatggcaggaattgaaactgtttat
aaagttggcggagcacaggcaattgcagctatgagttttggaacagaatctattccaaaa
gctgataaaatatttggtccaggaaatcaatacgtaacagcagcgaagcaatatgcacag
cgtttaggaattgcaatcgatatgccagctgggccttcagaagtgcttgtggcggcagat
aattcgattcctgcatcgtttgtggcagcggatttattggctcaagcagagcacggaaca
gattcacaagtgatttttctcagtgatcaaatcttattcgtggatgaagttctcactgaa
atagagaagcaacttgcaattctcccaagagccggaattgctagggaagctatgaaagcg
agtactgcaattgttgttgaagctgaaaactggtctgaaatcatcaattcatatgctcca
gaacacttgataattatggggaaatatgaagaacttgtgttgaaaaaagtaatcaatgct
ggaagtgtttttattggaaaaaatacagctgagagttttggcgattatgcctctggaacc
aatcatactttgcctacttctggatttgcacgatcgtatagtggggtatctttggattcc
ttcgtaaagaaaattacgtatcaaaaagtaagtgatgaaggaatccgaaatttagcgcaa
actgttattacaatggctgaagccgaagaactgcaaggacatgcaaatgcggtgaaagta
cgcttagaatatgcttcatcgataagagaacagcaaacctccgattcagtttctaaaatc
caaacatttattcgaaatgatttccgagatgtaaaatcgtacagttctgctcgtgatgaa
tttgaaggtttgggagaagtatttttggatgccaatgaaaatggattggtgacggcttac
aatcggtatccagatcctttgcagtttgaattgaaatcagaaatatcaattgcaaagaat
gttccaagtgaaaacatcttcctcggaaatggttcggatgaagtgctggacttgattttc
agactcacagcaactccttttttagattcggcagcatacttgaatccttcctatggaatg
tatccagtgcttgcaaaagtaaatggagtacgaactattcctatcaatttagattctaaa
tttaatatttcagtttctgaaatattgtctcaggctaatggttcaaaattgctagtcatt
tgtaatccaaacaatccaacaggtggaatcatatgcaaaacgaaaatcttagaaattgta
aaagaattcaatggagttgttgtcattgatgaagcttacattgatttttgcacctcaaat
tcggtggttgatgaagtgaataattatcccaatttgattgtcgttcaaacgctttctaag
gcttatggaatggctgggttaagaattggaatggcaattgcttcaagtgaatggattacg
gctctaaactccattaaaccaccttataatttaagttcgttggttcaaaaaacagcaata
aatgaattgaaatctatcaattggaaagctattaaaacgggaattattaacgaaagagaa
cgtttgataagttttttaaagtcgaataaaaaagtgatagaagtgtttccaacagaagcc
aacttcatcttattccgaattccaaatgcgacagaaatttacaacaagctcattaaaaag
ggagtaattgttagaaatcgaagcacacaatacaattgtgcagataccctgagagtgagt
gtaggtacaaaaatagaaaatgacaaattcattcaaatgatgcaaaaattatga

DBGET integrated database retrieval system