KEGG   Fluviicola taffensis: Fluta_3642Help
Entry
Fluta_3642        CDS       T01455                                 

Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
fte  Fluviicola taffensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Fluta_3642
Enzymes [BR:fte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Fluta_3642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4159547..4160599
Genome map
AA seq 350 aa AA seqDB search
MDNSTKFDPNGVGIANGNIFGFPVAEETANIVIIPVPWDATASYGKGTSDGPKAILDAST
QLDFYHHQLPEAWNTQVFMTPISDEMKQINDQMCIDTVQYIGFLEDGGELDENSPYNEVL
EKVNATSELLRNNLKERATKLLAENKIVAVLGGEHSTPLGLMEALNDQGEPFGILQIDAH
ADLREAYEGFQQSHASIMFNVLQSCHNLQKLVQVGIRDIAHSEVLLSNSDPRVKTFYDWD
LKKGLFEGQTWKEQVSMILNELPDRVYISFDIDGLLPSLCPNTGTPVVGGFELEQINYLF
FQLVESGKKIIGFDLNEVSPGKEGDWDANVGARALWNLVCATEKSRKINY
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggataattcaaccaaatttgatccaaatggtgttggaattgcaaatggaaatattttt
ggttttccagtagctgaagagacggcaaacattgtcattattcctgttccttgggatgct
acggcttcttacggaaaaggtactagtgatggcccaaaagcaattttagatgcaagtacg
caattggatttttaccaccatcagttgccagaagcatggaatacgcaagttttcatgact
ccaatttctgacgaaatgaaacagattaatgaccaaatgtgtattgatactgttcaatac
attggttttttggaagatggcggcgaattggatgaaaatagtccatacaatgaagttctt
gaaaaagtgaatgctacatcagagcttttgagaaacaacttgaaagaacgtgctaccaaa
ttacttgctgaaaataaaattgtagcagttcttggtggtgaacacagtactcccttaggt
ttaatggaagctttaaatgatcaaggagaaccatttggtattcttcaaattgatgcacat
gcagatttgagagaagcatacgaaggttttcagcaatcacatgcaagtattatgttcaat
gttcttcaatcttgtcacaatcttcaaaaactggttcaagttggcattcgcgacattgca
cattcggaagtattgctttcaaattcagatcccagagtaaaaacattctacgattgggac
ttgaaaaaaggattatttgaaggtcaaacatggaaagagcaagtctctatgattctgaat
gaattgccagatcgcgtttatatttcatttgatattgatgggcttttaccttcactttgt
cccaatacaggaactccagttgttggtggatttgagctagaacaaatcaattatctcttc
ttccaactggttgaatctggtaaaaaaatcattggtttcgacctcaatgaagtatctcct
ggaaaagaaggtgattgggatgccaatgtaggagcaagagcactttggaatttggtttgc
gcaactgaaaaaagcagaaaaataaactactga

DBGET integrated database retrieval system