KEGG   Fluviicola taffensis: Fluta_3725Help
Entry
Fluta_3725        CDS       T01455                                 

Definition
hypothetical protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
fte  Fluviicola taffensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4244378..4246024)
Genome map
AA seq 548 aa AA seqDB search
MEQKNLALVTGANGHLGNNLVRLLINKGIPVRASVRNIANKEPFVGLDCEVVQSDITDKQ
SLIKALQGVETFYAVGAAFKLWAKDPKKEIYDVNIQGTQNIVEAAAEAGVKRIVYVSSIA
ALNYNQLPTKESNGQNPDRRDMYYNSKNDGEKLAFELAKKHNIELVAVLPAAMIGSESFG
SLNVSYNVIDLILKKEIPVDTGITLNWIDVKDVAEGCFLAATKGRNGERYILANEKCTSI
TDTTKIAQKLLPELKITIPKAVPKPILYLIAWFMELGGKLNGKAPLLSVKDIAMFSGLKQ
DFDISKARKELGFNPKKPEIAIREAMIYLNNKRIDKKQPLNKLMTLIVFFLVASTTLFGQ
NSKPKADSTKVFVSIETDPAFWVGTLPNGLGFDANIDFRLAKHPSLRFGILGYSGKWSGE
FGKTVLLTKDYTEDNWVTQWNGIGVEAQYQFRFGLQRGGLQPGLRLQWNQFIYNQDNFKK
GEANHFVITPQVGFQWFPFKKIGLYVLPWAGVQIPTLGTDKIMINGAERDTRKIMPVVTA
HIGWEFKF
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaaaaatttagcattggttactggtgcaaacggacacctcggtaacaattta
gtaaggcttcttatcaacaaaggaattcctgttagggcttcggttcgcaacatcgccaac
aaagaaccatttgttggtttggattgtgaggtcgttcaatcggacatcacagacaaacaa
tccctcataaaagccttacaaggcgtagaaacattttatgccgttggtgctgcatttaaa
ctttgggcaaaagacccaaaaaaggaaatttacgatgtaaatatccaaggcactcaaaac
attgttgaagccgctgccgaagcaggagtaaaacgaatagtatatgtaagctctattgca
gcattaaattacaatcaacttccaacaaaagaaagcaatggacaaaacccagacagaagg
gatatgtattacaattcaaaaaatgatggagagaaattagcttttgaattagctaaaaaa
cacaacattgaattagttgctgttttaccagcggcaatgattggtagcgaatcatttggg
agtttaaatgtttcttacaatgttattgacctaattcttaaaaaagaaatacctgttgac
acaggtataaccttgaattggattgatgtaaaagatgtagcggagggttgttttttggcc
gccacaaaaggcaggaatggtgaacgctatattttggcgaatgagaaatgtacctctata
acggacaccactaaaattgctcaaaagctacttcctgaattaaaaataacaatacccaaa
gcagttcctaaacctatactttatttgattgcctggtttatggaattgggaggtaaacta
aatggcaaagcgcccttgctaagcgtaaaggatattgccatgttttcgggattgaaacaa
gatttcgatatatcgaaagcaagaaaggagttaggcttcaatcctaaaaagcctgaaatt
gcaattagagaagcaatgatttatttaaacaataaacgcatagacaaaaaacaaccctta
aataaactaatgacattgattgttttctttttggttgcttcaactaccttgtttggacaa
aattcaaaacctaaggctgattcaacaaaggtctttgtttccatagaaactgaccctgca
ttttgggtaggaactttaccaaatggtttaggatttgatgccaatatagattttagatta
gccaaacacccaagtttaagatttgggattttaggatattcaggaaaatggagtggagaa
ttcggaaaaactgttttactaacaaaagactatactgaagataattgggtaacacaatgg
aatggaattggagtggaagctcaatatcaatttagatttggtctgcaaaggggcggactt
caacctggacttagattacaatggaatcaatttatttacaaccaagacaatttcaaaaaa
ggagaggcaaatcactttgtaataacaccccaagttgggtttcaatggtttccgtttaag
aaaattggtttatatgttttaccttgggcaggtgttcaaattccgacactagggacagac
aaaataatgattaatggagcagaaagagatacgagaaaaataatgcctgtggtgacagct
cacatcggttgggagttcaaattttaa

DBGET integrated database retrieval system