KEGG   Fluviicola taffensis: Fluta_3921Help
Entry
Fluta_3921        CDS       T01455                                 

Definition
sulfate adenylyltransferase subunit 1 (EC:2.7.7.4)
Orthology
K00956  
sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
fte  Fluviicola taffensis
Pathway
Purine metabolism
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Fluta_3921
  Nucleotide metabolism
   00230 Purine metabolism
    Fluta_3921
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Fluta_3921
Enzymes [BR:fte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Fluta_3921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4446313..4447554)
Genome map
AA seq 413 aa AA seqDB search
MDLLRFFTAGNVDDGKSTLIGRLLYDSESISTDIIETLTRQSKTTGDNTTIDLALLTDGL
RAEREQGITIDVAYKYFSTDKRKFIIADTPGHAQYTRNMFTGASTAQLAIVLVDARNGIT
DQTKRHSIISATLGIPKVLLCINKMDLVAYSEDRFNEIVSEYQAFAELIGLKQVDFIPTS
ALAGDNVVYRSEKLSWYKGLPLLEYLETVEMDDGNLKEKSRFQVQIVIRPQTEALHDYRG
YAGSVLSGHFQVGDEVTILPSGAQTRISKIESNLKEVETAVKNQPVVLHLEDNLDISRGN
TIVPRNELPQTEKSLHATICWMDSFAFNSGQKFLLQQNSFRTKAMIKEIHSKIDIHSFQD
LGSDGSLHLNELAKVSIKTADGVSFDLFKQLPKTGAFILINENTNQTVAAGVI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggatttattacgattttttacggcaggaaatgtagacgatggaaagagtaccttaatc
gggcgcttactttacgatagtgaatcaatttctactgatattatagaaacactgactcgt
cagagtaaaacaactggtgataacactacaatcgatttggctttattgacagatggttta
cgtgcagaacgagaacaagggattacaatcgacgtggcttacaagtatttttctacggac
aaacgcaagtttatcattgcagatactcctggacatgcacaatacacgcggaacatgttc
acaggagcttcaacagcgcagttggcaattgttctggtggatgcacgaaatggcattacg
gatcaaacgaaacggcacagcattatctctgcaacacttggaattccaaaggtattgttg
tgtatcaataaaatggatttggtggcttacagtgaagatcgtttcaatgaaattgtttcc
gagtatcaagcatttgcagaactaatcggtttgaaacaggtcgattttatcccaacttcc
gctttagctggtgataatgtggtttatcgttcagaaaaactgagctggtataagggattg
cctttattggagtatttggaaacagtagaaatggatgatggaaatttgaaagagaaatca
cgctttcaggtacagattgtcattcgtccccaaacggaagcattgcatgattacagaggt
tatgcgggaagtgtcttgagcggacactttcaggtaggagatgaggtgaccattttacct
tctggagcacaaacacgaataagtaaaatagagtctaatttgaaggaagtagagactgcg
gtgaaaaaccaaccggttgttttgcatttggaggataatttggacatcagtcgagggaat
accattgtccctagaaatgaacttcctcaaaccgagaagtcattgcatgctacgatttgt
tggatggatagctttgcatttaattcaggacaaaaatttttattgcagcaaaatagtttt
cgcacaaaagcaatgatcaaagaaattcattcgaagattgacattcacagttttcaagat
cttggaagtgatgggagtcttcacttaaatgaattggcaaaggtttccattaaaactgca
gacggagttagtttcgacttattcaaacaattgccgaaaacgggagcttttattctaatc
aatgaaaacacgaatcaaacagtggcagcaggagtcatttag

DBGET integrated database retrieval system