KEGG   Fluviicola taffensis: Fluta_3921Help
Entry
Fluta_3921        CDS       T01455                                 

Definition
sulfate adenylyltransferase subunit 1 (EC:2.7.7.4)
Orthology
K00956  
sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
fte  Fluviicola taffensis
Pathway
Purine metabolism
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:fte00920]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:fte00230]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:fte00450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4446313..4447554)
Genome map
AA seq 413 aa AA seqDB search
MDLLRFFTAGNVDDGKSTLIGRLLYDSESISTDIIETLTRQSKTTGDNTTIDLALLTDGL
RAEREQGITIDVAYKYFSTDKRKFIIADTPGHAQYTRNMFTGASTAQLAIVLVDARNGIT
DQTKRHSIISATLGIPKVLLCINKMDLVAYSEDRFNEIVSEYQAFAELIGLKQVDFIPTS
ALAGDNVVYRSEKLSWYKGLPLLEYLETVEMDDGNLKEKSRFQVQIVIRPQTEALHDYRG
YAGSVLSGHFQVGDEVTILPSGAQTRISKIESNLKEVETAVKNQPVVLHLEDNLDISRGN
TIVPRNELPQTEKSLHATICWMDSFAFNSGQKFLLQQNSFRTKAMIKEIHSKIDIHSFQD
LGSDGSLHLNELAKVSIKTADGVSFDLFKQLPKTGAFILINENTNQTVAAGVI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggatttattacgattttttacggcaggaaatgtagacgatggaaagagtaccttaatc
gggcgcttactttacgatagtgaatcaatttctactgatattatagaaacactgactcgt
cagagtaaaacaactggtgataacactacaatcgatttggctttattgacagatggttta
cgtgcagaacgagaacaagggattacaatcgacgtggcttacaagtatttttctacggac
aaacgcaagtttatcattgcagatactcctggacatgcacaatacacgcggaacatgttc
acaggagcttcaacagcgcagttggcaattgttctggtggatgcacgaaatggcattacg
gatcaaacgaaacggcacagcattatctctgcaacacttggaattccaaaggtattgttg
tgtatcaataaaatggatttggtggcttacagtgaagatcgtttcaatgaaattgtttcc
gagtatcaagcatttgcagaactaatcggtttgaaacaggtcgattttatcccaacttcc
gctttagctggtgataatgtggtttatcgttcagaaaaactgagctggtataagggattg
cctttattggagtatttggaaacagtagaaatggatgatggaaatttgaaagagaaatca
cgctttcaggtacagattgtcattcgtccccaaacggaagcattgcatgattacagaggt
tatgcgggaagtgtcttgagcggacactttcaggtaggagatgaggtgaccattttacct
tctggagcacaaacacgaataagtaaaatagagtctaatttgaaggaagtagagactgcg
gtgaaaaaccaaccggttgttttgcatttggaggataatttggacatcagtcgagggaat
accattgtccctagaaatgaacttcctcaaaccgagaagtcattgcatgctacgatttgt
tggatggatagctttgcatttaattcaggacaaaaatttttattgcagcaaaatagtttt
cgcacaaaagcaatgatcaaagaaattcattcgaagattgacattcacagttttcaagat
cttggaagtgatgggagtcttcacttaaatgaattggcaaaggtttccattaaaactgca
gacggagttagtttcgacttattcaaacaattgccgaaaacgggagcttttattctaatc
aatgaaaacacgaatcaaacagtggcagcaggagtcatttag

DBGET integrated database retrieval system