KEGG   Fluviicola taffensis: Fluta_3921Help
Entry
Fluta_3921        CDS       T01455                                 

Definition
(GenBank) sulfate adenylyltransferase subunit 1
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
fte  Fluviicola taffensis
Pathway
fte00230  Purine metabolism
fte00261  Monobactam biosynthesis
fte00450  Selenocompound metabolism
fte00920  Sulfur metabolism
fte01100  Metabolic pathways
fte01120  Microbial metabolism in diverse environments
fte01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Fluta_3921
  Nucleotide metabolism
   00230 Purine metabolism
    Fluta_3921
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Fluta_3921
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Fluta_3921
Enzymes [BR:fte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Fluta_3921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU MMR_HSR1 GTP_EFTU_D2 cobW SRPRB
Motif
Other DBs
NCBI-ProteinID: AEA45885
UniProt: F2IHS6
Position
complement(4446313..4447554)
Genome map
AA seq 413 aa AA seqDB search
MDLLRFFTAGNVDDGKSTLIGRLLYDSESISTDIIETLTRQSKTTGDNTTIDLALLTDGL
RAEREQGITIDVAYKYFSTDKRKFIIADTPGHAQYTRNMFTGASTAQLAIVLVDARNGIT
DQTKRHSIISATLGIPKVLLCINKMDLVAYSEDRFNEIVSEYQAFAELIGLKQVDFIPTS
ALAGDNVVYRSEKLSWYKGLPLLEYLETVEMDDGNLKEKSRFQVQIVIRPQTEALHDYRG
YAGSVLSGHFQVGDEVTILPSGAQTRISKIESNLKEVETAVKNQPVVLHLEDNLDISRGN
TIVPRNELPQTEKSLHATICWMDSFAFNSGQKFLLQQNSFRTKAMIKEIHSKIDIHSFQD
LGSDGSLHLNELAKVSIKTADGVSFDLFKQLPKTGAFILINENTNQTVAAGVI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggatttattacgattttttacggcaggaaatgtagacgatggaaagagtaccttaatc
gggcgcttactttacgatagtgaatcaatttctactgatattatagaaacactgactcgt
cagagtaaaacaactggtgataacactacaatcgatttggctttattgacagatggttta
cgtgcagaacgagaacaagggattacaatcgacgtggcttacaagtatttttctacggac
aaacgcaagtttatcattgcagatactcctggacatgcacaatacacgcggaacatgttc
acaggagcttcaacagcgcagttggcaattgttctggtggatgcacgaaatggcattacg
gatcaaacgaaacggcacagcattatctctgcaacacttggaattccaaaggtattgttg
tgtatcaataaaatggatttggtggcttacagtgaagatcgtttcaatgaaattgtttcc
gagtatcaagcatttgcagaactaatcggtttgaaacaggtcgattttatcccaacttcc
gctttagctggtgataatgtggtttatcgttcagaaaaactgagctggtataagggattg
cctttattggagtatttggaaacagtagaaatggatgatggaaatttgaaagagaaatca
cgctttcaggtacagattgtcattcgtccccaaacggaagcattgcatgattacagaggt
tatgcgggaagtgtcttgagcggacactttcaggtaggagatgaggtgaccattttacct
tctggagcacaaacacgaataagtaaaatagagtctaatttgaaggaagtagagactgcg
gtgaaaaaccaaccggttgttttgcatttggaggataatttggacatcagtcgagggaat
accattgtccctagaaatgaacttcctcaaaccgagaagtcattgcatgctacgatttgt
tggatggatagctttgcatttaattcaggacaaaaatttttattgcagcaaaatagtttt
cgcacaaaagcaatgatcaaagaaattcattcgaagattgacattcacagttttcaagat
cttggaagtgatgggagtcttcacttaaatgaattggcaaaggtttccattaaaactgca
gacggagttagtttcgacttattcaaacaattgccgaaaacgggagcttttattctaatc
aatgaaaacacgaatcaaacagtggcagcaggagtcatttag

DBGET integrated database retrieval system