KEGG   Francisella tularensis subsp. tularensis FSC 198: FTF0130Help
Entry
FTF0130           CDS       T00381                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ftf  Francisella tularensis subsp. tularensis FSC 198
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ftf00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
141982..143490
Genome map
AA seq 502 aa AA seqDB search
MSKDFILAVDQGTTSSRAIIFDKKGNIRKIAQKEFTQIYPKSGWVEHDAMEIWGTQSGVM
REALEFGRVKPDQIAAIGITNQRETVVVWDKETGDPVYNAIVWQCRRTSSICDEIKRDPQ
FVKYIKENTGLVVDAYFSGTKVKWILDNVEGAREKANAGKLLMGTIDTWLIWNLTRGKVH
ATDYSNASRTMLFNINSLEWDKKILDYLNIPESMLPEVKNSSEVFGVTDSHTLGGAEIPI
AGVAGDQHAALFGHCCFEKGMAKNTYGTGCFALMNVGDKPVYSDEGLLTTIAWAENGKPT
YALEGSVFIAGAVIQWIRDGLGLVRSAEDSEYYATKIDSTNGVYLVPAFVGLGTPYWDMY
ARGTIVGITRDTKREHIIRAALEAIAYQAKDVLECMKEDTGLDLAGLRVDGGAVQNNFLM
QFQSDILQSEISKPKVNEITGLGAVFLAGLAVGFWKDKQELKSILTTEKVFEPQKDSQAV
AHDYRGWKKAVERSKAWAECYS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagatttcatcttagctgtagatcaaggtacaacaagttcacgagcaattatc
tttgataaaaagggtaatataagaaagattgctcaaaaagaattcacacaaatatatcct
aaaagtggttgggtagaacatgatgcaatggaaatatggggtactcaaagtggcgtaatg
cgtgaggcactagagtttggccgcgttaagccagatcaaattgcagcaataggtattaca
aatcagcgcgagacagttgtagtttgggataaagaaacaggtgatcctgtctataatgct
atagtgtggcaatgtcgccgtacttcgagtatttgtgatgaaatcaaacgagatcctcaa
tttgtcaaatatatcaaagaaaatactggtctggttgtagatgcgtatttttcaggcact
aaagtaaaatggattttagataacgttgaaggtgctagagaaaaagcaaatgccggcaaa
ttattaatgggtactatagatacttggttgatttggaatctaactcgcggtaaagtgcat
gcgacagactatagtaatgcttcgcgcactatgttatttaatattaatagtttagagtgg
gataaaaaaatacttgattacttaaatattcctgaatcaatgttacctgaggttaaaaac
tcaagtgaggtttttggagttacagatagccatactttaggtggtgctgagattcctatt
gctggtgttgcaggagatcagcatgcagcattatttggtcattgctgttttgaaaaaggt
atggcaaaaaatacttatggtacgggttgttttgccttgatgaatgtcggcgataagcca
gtttattcagatgaaggtttattgaccactatcgcatgggcagaaaatggtaagccaact
tatgctttagaaggtagtgtatttatagcaggagctgttattcagtggattcgtgatggt
ttgggactagtgcgttctgctgaggatagtgagtactatgctactaagattgattctaca
aatggtgtatatttggtgcctgcgtttgttggtcttggcacaccatattgggatatgtat
gctcgtggtacgatagttggtattacccgcgatacaaagcgtgagcatattattcgtgca
gctctagaggctatagcatatcaagctaaagatgtcttagaatgtatgaaagaggatacg
ggacttgatcttgctggtttgcgtgttgatggtggcgcggtacaaaataacttcctaatg
cagtttcaatctgatattttacaatctgaaatctcaaaaccgaaagtaaatgaaattact
ggtttgggggctgtcttcttagctggtttagcagttggtttttggaaggataaacaagaa
ttgaaatctattcttacaactgaaaaagtttttgaaccgcaaaaagactctcaagctgtt
gctcatgattatagaggttggaagaaagcagtagaaagaagtaaggcttgggcagagtgt
tatagttaa

DBGET integrated database retrieval system