KEGG   Francisella tularensis subsp. tularensis FSC198: FTF0195cHelp
Entry
FTF0195c          CDS       T00381                                 

Definition
L-glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FTF0195c
   00330 Arginine and proline metabolism
    FTF0195c
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    FTF0195c
Enzymes [BR:ftf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     FTF0195c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(212466..214007)
Genome map
AA seq 513 aa AA seqDB search
MKTIMIKTTSSSGEDYYKNIFSAICDKDGFMTKTDILDILVESGISNDDPRITKLIAKLN
KFCDIDKIDFDTFQEITFENIGLIEKAINKGFIIPNFKDFKKEIEAIYNETKKNETGRNA
NYIPQLARVDPNLFAVAFCSVDGQIITLGDYLQPYCVQSTAKTITYCIATEENGEDKVHQ
HVGREPSGITFNAIALNKYDLPHNPMINSGAIMMCSLIKPEWNLADRFEYITNVWQDLAG
GEPIGFDNAVYHSEKETADRNYALAHFMKEVGAFPEGTNIHTALDFYFQTCSIQVNAKKM
AKIMASIANGGVCPFTSKKIFSPTTIRNCLSMMYSCGMYDFSGEYAFSVGLPAKSGVSGA
LAIAIPNVGGFAIFSPRLDPNHNSVRGVEFSKRLIEKFSFHNYDHITHCDKINPVENRMV
VESNLTFELIWAASAGDLSEIKRAVALGVDINKGDYDKRTALHLAAAEGHEDIVKYLIRK
GADINAIDRWGKKPLDDAIMNNNISIIELLDRT
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaataatgattaaaactacatcttctagtggtgaagattactataaaaatatt
tttagcgctatctgtgacaaagatggctttatgacaaagacagatattcttgatatctta
gttgagtcaggtattagcaatgatgatcctcgcattactaaattaatcgccaaattaaat
aaattctgtgatattgataagattgattttgatacatttcaagaaattacttttgaaaat
ataggtcttatcgaaaaagctattaataaaggctttatcattcccaactttaaggatttc
aaaaaagaaattgaagccatatataacgaaactaaaaagaatgaaacaggcagaaacgca
aactatattcctcaactagcaagggttgaccctaatctttttgctgtggctttttgtagt
gttgatggtcaaataattaccttaggagattatctacaaccatactgtgtacaatcaact
gcaaaaactatcacatattgtatagctactgaagaaaatggcgaagataaagttcatcaa
catgttggcagagaaccaagtggtattacttttaatgctatagcattaaacaagtatgac
ctacctcataatccaatgataaactccggcgctatcatgatgtgctcactaataaaaccg
gagtggaatcttgctgatagatttgaatatattactaacgtttggcaagatctagcaggt
ggcgaacctatcggctttgataacgctgtatatcactccgaaaaagagaccgcagataga
aattatgctctagctcattttatgaaagaagtaggtgcttttccagagggcacaaatatc
cacactgctctagatttctatttccaaacttgctctattcaagttaacgcaaaaaaaatg
gcaaaaattatggcttccatagctaatggcggagtatgcccttttactagtaaaaaaata
ttttcaccaacaacgattcggaattgcttatcaatgatgtactcgtgtgggatgtatgat
ttttcaggtgaatatgcgttctctgttggattacctgcaaaatcaggggtgtcaggagct
ctagctatagctattccaaatgttggtggttttgcaattttttctcctcgacttgaccct
aatcataactccgtaagaggtgttgaatttagtaaaaggctaatagagaagtttagtttc
cataactatgatcatataactcattgtgacaaaataaatcccgttgagaatagaatggtt
gtcgaatcaaatttaacatttgaactaatttgggcagcaagtgccggtgacttatcagag
attaaaagagccgttgccttaggtgttgatattaacaaaggtgattatgataaaagaaca
gctcttcacctagccgctgctgaaggtcatgaagatattgttaaataccttatccgcaaa
ggagcggatattaatgctatagacagatggggtaaaaagccattagatgatgctataatg
aataataatatttctataattgagctgttagacagaacttaa

DBGET integrated database retrieval system