KEGG   Francisella tularensis subsp. tularensis FSC198: FTF0298Help
Entry
FTF0298           CDS       T00381                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III (CHI subunit) protein
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
Pathway
ftf00230  Purine metabolism
ftf00240  Pyrimidine metabolism
ftf01100  Metabolic pathways
ftf03030  DNA replication
ftf03430  Mismatch repair
ftf03440  Homologous recombination
Module
ftf_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ftf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FTF0298 (holC)
   00240 Pyrimidine metabolism
    FTF0298 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    FTF0298 (holC)
   03430 Mismatch repair
    FTF0298 (holC)
   03440 Homologous recombination
    FTF0298 (holC)
Enzymes [BR:ftf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     FTF0298 (holC)
DNA replication proteins [BR:ftf03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     FTF0298 (holC)
DNA repair and recombination proteins [BR:ftf03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     FTF0298 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: CAL08314
Position
311769..312209
Genome map
AA seq 146 aa AA seqDB search
MMKIEFKVLQTQDINQMLEVLITEVVKEYALQKTIAILAPAGIAKQLDDKLWQDGQDSFI
PHHCAINAREYNQYNNIPILITDNLFITSGYDVLINIMDVAVDPQRVKVKELKEFVYQQD
SALQASRKKYVYYKKSNLEIITVQDN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaatagagtttaaggttttgcagacacaagatattaatcaaatgctagaagtg
ctgattactgaagttgtcaaagaatatgctttacaaaagacaattgcaatcttagcacca
gcaggtattgcaaaacaactagatgataaactatggcaagatggtcaagattcttttatc
ccacatcattgtgctataaatgctagagagtataatcaatataataatattccaattctt
atcacagataatctatttattacctcaggttatgatgttttaataaatattatggatgtg
gctgtagacccacagcgagttaaagtcaaagagctaaaagagtttgtctatcaacaagat
agcgctttacaggcttcacgtaagaagtatgtttactacaaaaaatcaaatctagagata
attactgttcaagataactaa

DBGET integrated database retrieval system