KEGG   Francisella tularensis subsp. tularensis FSC198: FTF0298Help
Entry
FTF0298           CDS       T00381                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ftf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FTF0298 (holC)
   00240 Pyrimidine metabolism
    FTF0298 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    FTF0298 (holC)
   03430 Mismatch repair
    FTF0298 (holC)
   03440 Homologous recombination
    FTF0298 (holC)
Enzymes [BR:ftf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     FTF0298 (holC)
DNA replication proteins [BR:ftf03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     FTF0298 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
311769..312209
Genome map
AA seq 146 aa AA seqDB search
MMKIEFKVLQTQDINQMLEVLITEVVKEYALQKTIAILAPAGIAKQLDDKLWQDGQDSFI
PHHCAINAREYNQYNNIPILITDNLFITSGYDVLINIMDVAVDPQRVKVKELKEFVYQQD
SALQASRKKYVYYKKSNLEIITVQDN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaatagagtttaaggttttgcagacacaagatattaatcaaatgctagaagtg
ctgattactgaagttgtcaaagaatatgctttacaaaagacaattgcaatcttagcacca
gcaggtattgcaaaacaactagatgataaactatggcaagatggtcaagattcttttatc
ccacatcattgtgctataaatgctagagagtataatcaatataataatattccaattctt
atcacagataatctatttattacctcaggttatgatgttttaataaatattatggatgtg
gctgtagacccacagcgagttaaagtcaaagagctaaaagagtttgtctatcaacaagat
agcgctttacaggcttcacgtaagaagtatgtttactacaaaaaatcaaatctagagata
attactgttcaagataactaa

DBGET integrated database retrieval system