KEGG   Francisella tularensis subsp. tularensis FSC 198: FTF0312cHelp
Entry
FTF0312c          CDS       T00381                                 

Gene name
folA
Definition
dihydrofolate reductase type I (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ftf  Francisella tularensis subsp. tularensis FSC 198
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ftf00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ftf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(327717..328217)
Genome map
AA seq 166 aa AA seqDB search
MISLIVAYDKNFGIGKENTLAWKLSEDLKNFKKITENNYIVMGRKTFESIGRPLPNRKNI
ILTRDKDYKQDKCLIINSTQDILNFAESKPHYEIFIIGGAQIYKEFLKYADRLYITEVDA
EMTDLDAFFPQWDKSKYKRIGHKQFKKDDKNEFDFTFSVFEKNKNL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgatctcactaatcgttgcttatgataaaaactttggtataggtaaagaaaatactcta
gcatggaaactatcagaagatcttaagaactttaaaaaaataacagaaaacaactatatt
gttatgggtagaaaaacctttgaatcgattggtcgcccactaccgaatcgtaaaaatatt
attttaactagagacaaagattacaaacaagataaatgtttaataataaatagtactcag
gatattttaaattttgctgaatcaaaaccacactacgaaatatttataatcggtggtgca
cagatctataaagaatttctaaaatacgcagatagattgtatataaccgaagttgatgca
gaaatgactgatcttgatgctttctttccacaatgggataaatcaaaatataaacgtatt
ggtcacaaacaattcaaaaaagatgataaaaatgagtttgactttacatttagcgtcttt
gaaaaaaataaaaatttgtaa

DBGET integrated database retrieval system