KEGG   Francisella tularensis subsp. tularensis FSC198: FTF0428Help
Entry
FTF0428           CDS       T00381                                 

Gene name
thrC1
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FTF0428 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTF0428 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FTF0428 (thrC1)
Enzymes [BR:ftf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FTF0428 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
442964..444250
Genome map
AA seq 428 aa AA seqDB search
MNFISTRDKNIKVSLSEAMQSGLAPDGGLFVLERFPTVNWQSFAKDISYAKFAANTLREF
FKGDQLEDSLDKICNNAFTFEVPVRRLDKTTSVLELFHGPTLSFKDFGARFLANCLSSID
SEKPFTILVATSGDTGSAVAAAFHGKSNIRVIVMFPKGKISKRQEKQITCWGDNIQAVEV
EGVFDDCQSLVKEAFKTPWWTERTKLNTSNSINIGRLLPQSTYYAYTSWQHYLQTGEKAN
YIVPSGNIGNITAAFWAKQMGFPIGEISMSLNANDTVVDYLETGKFNPKASVETLANAMD
VGNPNNFERLLYLLGNYENFKANVKAICVSDFEIIEEIKQVYRQYHEVVCPHTATGFVAK
NQLDSNKDYIIVATAHPAKFESVIEPILDIQVPPTPALQKLLDKEQNKVVINKSMDELCE
VYTKAFEA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattagtactagagataaaaatattaaagtttcactaagtgaagcgatgcag
tctggattagctcctgatggaggattatttgtcctagagagatttcctacagttaattgg
cagagttttgctaaagatatcagttacgcgaagtttgctgctaatactctaagagaattc
tttaaaggagatcagctagaagactctttagataaaatttgtaataatgcttttactttt
gaggttcctgtaagaagattagataaaaccacatcagttttagagctttttcatggtcca
actttatcttttaaagatttcggtgcgagatttttagcaaactgtttaagctctatcgat
agtgagaagccatttactattttagtggcaacttctggagatacgggttcagcagtagct
gcagcttttcatggtaagagcaatatccgtgttatagtgatgtttcctaaaggtaaaatc
tctaaaagacaagaaaagcagataacttgttggggagataatatccaagcagttgaagtt
gaaggagtttttgatgactgtcaaagtctagtcaaagaagcttttaagacaccttggtgg
acagagaggactaagttaaatacatcaaatagtattaatatcggtagattactaccacaa
tcaacttattatgcttatacatcgtggcaacattatttgcagaccggagagaaagcaaac
tatatagttccatctggcaatattggtaatataactgctgctttttgggcaaagcaaatg
ggctttccaataggtgaaatatcgatgagtttaaatgctaatgatactgttgttgactat
ctagagactggtaagtttaatcctaaggcaagtgttgaaacgctagcaaatgctatggat
gttggtaaccctaataattttgaaagattgttatacttgttgggtaattatgaaaatttc
aaagctaatgttaaggctatatgtgtttctgactttgaaattatagaagaaataaaacaa
gtgtatcgtcaatatcatgaagttgtttgtccacacacagcaacaggttttgtagcaaaa
aatcagttagatagcaataaagattatataatcgtagcaactgcacatcctgctaagttt
gaaagtgtaattgagcctatattagatatacaagtgccgcctacaccggcgttacaaaag
ctactagacaaagagcaaaataaagtagttataaataagtctatggatgagctgtgcgag
gtttatacaaaagcttttgaagcttag

DBGET integrated database retrieval system