KEGG   Francisella tularensis subsp. tularensis FSC198: FTF0462Help
Entry
FTF0462           CDS       T00381                                 

Gene name
hemB
Definition
(GenBank) Delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
Pathway
ftf00860  Porphyrin and chlorophyll metabolism
ftf01100  Metabolic pathways
ftf01110  Biosynthesis of secondary metabolites
ftf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ftf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FTF0462 (hemB)
Enzymes [BR:ftf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     FTF0462 (hemB)
Exosome [BR:ftf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FTF0462 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: CAL08478
Position
478351..479325
Genome map
AA seq 324 aa AA seqDB search
MSFPISRPRRLRVTQAFRDIVAETTLSLDDLMYPIFVVHGQGVKKEISSMPNQYHWSVDM
LDELVDQVVKAGIRSLMIFGVPKIKDLVSSENYDPNGITQQAIRKIKQLAPELVIATDVC
MCSFTPHGHCGILDEHDYVDNDQTLEILQKTAVSHAQAGADIVAPSGMMDGMIIAMRQAL
DEASFENVSIMSYSVKYASAYYGPFRSACSSSLKGDRKTYQMDYRNKKEAICEALADIEQ
GADFIMVKPALSYLDIVNELSHIIDLPIAAYHVSGEYAMIKAAASAGLVDEKAITIETLI
SMKRAGAKVILTYTALDVANWLKV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagctttccaatatcacgtccacgtagacttagggttacacaagcttttcgcgatatc
gttgctgagacaactttaagccttgatgacttaatgtatccaatatttgttgtgcatggt
caaggagttaaaaaagaaatttcaagtatgccaaatcaatatcattggtcagttgacatg
cttgatgagttagtagatcaagttgtcaaggctggaataaggagtctaatgatatttggc
gtgccaaaaatcaaagatcttgtttcatcggagaattatgatcctaatggaataacacag
caagcaattagaaagattaaacaacttgctcctgagcttgtgatagctacagatgtatgt
atgtgtagttttacaccacatggtcattgtggaattttagatgagcatgattatgttgat
aacgatcaaacattagaaatattacaaaaaacggctgtttctcatgctcaagctggagca
gatattgtagcaccaagtgggatgatggatggtatgataattgcgatgcgtcaggcacta
gatgaggcaagctttgagaatgtgagtattatgtcatactcagttaaatatgcatcggca
tattatggaccatttagaagtgcttgtagttcgtcacttaagggagatcgtaaaacttat
cagatggattatcgcaataagaaagaggcaatctgtgaggcgcttgcagatattgagcag
ggtgcagattttattatggttaaaccagctttgagttatctggatattgtcaatgagtta
agtcatattatagatttaccaatagcagcatatcatgtcagtggtgaatatgcgatgata
aaagctgctgctagtgctggtttagttgatgaaaaagcaatcactatagaaacactcata
tcaatgaaaagagcaggtgctaaagtgatacttacatatactgcgttggatgtggctaat
tggttaaaggtttaa

DBGET integrated database retrieval system