KEGG   Francisella tularensis subsp. tularensis FSC198: FTF0658Help
Entry
FTF0658           CDS       T00381                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ftf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FTF0658 (ruvA)
Enzymes [BR:ftf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     FTF0658 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
677520..678173
Genome map
AA seq 217 aa AA seqDB search
MMISFIKGVLIEKDPTALLIDVNGIGYEVFVPMTTFYTLGDIDSQVSLYTHFVVREDAQQ
LYGFKSKVDKKVFQELIKVNGIGARTAIAILSGMDSKTLLHCIENKDYALLATVPGIGKK
TAERLVVEIYDKLLKMANEIYAQTSGTTTTSQDSQAQQAPTSVVLANSIFNESVDALLAL
GYKQKDAEKMARSAMGDATTVAEVIRKALQGSIKSKR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgatgataagttttataaaaggtgtattgatagagaaagatccaacagctttgcttatt
gatgtaaatggtattggttatgaagtttttgtaccgatgacaacattttatacattaggt
gatattgatagtcaggttagcctttatacacattttgtagttcgtgaagatgctcagcaa
ctctatgggtttaaatcaaaagttgataagaaagttttccaagagttaattaaagtcaat
ggtataggagctagaacagctattgctattttatctggtatggattcaaaaactctatta
cattgtattgaaaataaagattatgctttattagctacagtgccaggaattggtaaaaaa
actgctgagcgtttagttgtagaaatttatgataagttattaaaaatggctaatgagatt
tatgctcagacttcaggtacaactacaactagtcaagattcacaagcacaacaggcacca
acatctgtagtattagcaaactcaatatttaacgaatccgttgatgcattattggcatta
ggctataagcaaaaagatgctgaaaaaatggctcgctctgctatgggtgatgcaactaca
gtagcagaggtaattcgtaaagctctgcaaggatcaataaaatcaaaaagataa

DBGET integrated database retrieval system