KEGG   Francisella tularensis subsp. tularensis FSC198: FTF0733Help
Entry
FTF0733           CDS       T00381                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ftf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    FTF0733
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FTF0733
Enzymes [BR:ftf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FTF0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
755119..755589
Genome map
AA seq 156 aa AA seqDB search
MSIYDFKLTANDGSEYHLPKNKVLLIVNVASKCGFTKQYRGLQHLHKIYPDLEIVAFPCN
SFGGQEPGSDEEIKNFCETNYNVTFPIMKKTKVNGKDAEPLFEYLKERAKGVLGTEAIKW
NFTKFLVSKDGETIVRYAPKTIPEDLIPDIDNFLKD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttatgactttaagctaactgcaaatgatggttcagaatatcatctgcctaaa
aataaagtgcttttgatagttaatgttgcgagtaagtgcggttttactaagcagtataga
ggtttgcaacatttacataaaatatatccagatttagaaattgttgcattcccttgtaat
tcatttggtggacaggagccaggtagtgacgaagaaatcaagaatttctgtgaaactaat
tataatgtcacatttccaattatgaaaaaaaccaaagtaaatggtaaagatgctgagcca
ttgtttgagtatctcaaagaaagagcaaaaggagtcttaggaactgaagctataaagtgg
aattttactaagtttttagtatcaaaagatggcgagaccatcgtaagatatgcacctaaa
actattccagaagatttaattccagatattgataattttctaaaagactaa

DBGET integrated database retrieval system