KEGG   Francisella tularensis subsp. tularensis FSC198: FTF0928cHelp
Entry
FTF0928c          CDS       T00381                                 

Definition
(GenBank) Beta-glucosidase-related glycosidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
Pathway
ftf00520  Amino sugar and nucleotide sugar metabolism
ftf01100  Metabolic pathways
ftf01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ftf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FTF0928c
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    FTF0928c
Enzymes [BR:ftf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FTF0928c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 TPP_enzyme_M CheF-arch
Motif
Other DBs
NCBI-ProteinID: CAL08944
Position
complement(939353..941020)
Genome map
AA seq 555 aa AA seqDB search
MSTNSNIRQKLGQLIMMDFRYWGEDSNNQRIPFTKTNDIVNKIFKDYNLGGFILFRENIQ
NNEQVISLLRDLQANTNTPIFFATDQEGGRVNRLQQGISGCGNMALAATDNPHNAYTMAK
IIGDELYSLGININFAPAVDVNSNKNNPIIGVRSYSDNPDIVIDYAKNAINGYHDAKIID
CIKHFPGHGDTATDSHLGNVNLDKTLKELQTTELLPFSKLARDCSMIMTAHISVPALDDT
QYQSVSTSENIYVPATLSYKIITKLLKQQMKFDGLVVSDAMDMHAIAKHFGTIEASKLAI
LAGIDILLMPVRVWSENDLYKLEELFCELEKGYNQNSNFANAVDNVYTNITDFKAKHKLD
ESLIFKLSQDEQLKYANQIVNSNKHQQIALDIAKQSTTVVKNSGIIPCDLNKLKNILIVD
SDNQRLADFHSELQKIVLDNNSNVIINCENINNHNIKTIIENADLILLISANLREYNQTY
SYITSIKPEQTINIAALTPYDINYIDNIINYVCIYGATSMDYTNYTKTSLKINIQTTLEN
IFGNKEIKGVLPVSL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaactcaaatataagacaaaaactaggtcaactaattatgatggattttcgc
tattggggtgaagattcaaataatcagcgtataccttttacaaaaactaatgatatcgtc
aataagatctttaaagactataatttaggtggttttatcctttttagagagaatattcaa
aataatgagcaagttatctctctattaagagatcttcaagctaacaccaatacaccaata
tttttcgctacagatcaagaaggtggcagagttaatcgcttacaacaaggtattagtggt
tgcggtaatatggcactagctgcaacagataatcctcataatgcctatactatggctaaa
ataattggcgatgaattatattctttaggtatcaatattaattttgctccagctgtggat
gttaactctaacaaaaataatcctattattggtgtaagatcatactcagataatcctgat
atagttattgactacgccaaaaatgctataaatggttatcatgatgcaaaaattatagac
tgcattaaacatttccctggtcatggtgatactgcaacagatagtcatttaggcaatgta
aacttagataaaactttgaaagaattacagacaacagagctactaccctttagtaaactt
gctagagattgtagtatgataatgacagcacatattagtgtaccagccctagatgacacc
cagtatcaatcagtttcaacaagtgagaatatttatgtgccagccaccctctcttataaa
ataataactaaattactaaaacaacaaatgaaatttgatggtttagtagtatctgatgcc
atggacatgcatgctattgctaaacactttggaactattgaggcttctaaattagctatc
ttagctggtatagatattttattaatgcctgttcgagtatggtcagaaaatgatctttat
aaattagaagagcttttttgtgaactagaaaaaggatataatcaaaattctaattttgct
aatgcagttgataatgtctatacgaatattactgatttcaaagcaaaacataaactcgat
gaaagtttaatattcaagctctcacaagatgagcaattaaaatatgctaatcaaatagtt
aactctaataaacatcaacaaatagctttagatattgctaaacaaagtacaactgtagtt
aaaaattcaggtattattccatgcgatctcaataagctaaaaaatatcttgattgtagat
agtgataaccaacgcttagcggattttcatagcgagttgcagaaaatagtattagacaat
aactcaaatgttattattaactgcgaaaatattaataaccataatattaaaactattatc
gaaaatgccgatctgatcctattaatttcagcgaatcttcgtgaatataatcagacctat
agttatataacttctataaagccagagcaaactataaatatagcagcacttactccttat
gatattaattatatagataatattattaattatgtttgtatttatggtgcaacttctatg
gattatacaaactatacaaagacttcactaaagattaatattcaaacaacattagaaaat
atttttggtaataaagagattaaaggagtactaccagtcagtttataa

DBGET integrated database retrieval system