KEGG   Francisella tularensis subsp. tularensis FSC 198: FTF0932Help
Entry
FTF0932           CDS       T00381                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ftf  Francisella tularensis subsp. tularensis FSC 198
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:ftf01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ftf00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ftf00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ftf00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ftf00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ftf00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944056..944907
Genome map
AA seq 283 aa AA seqDB search
MVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEVEGIG
VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK
QYENFVGITIGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYCSGQFFIKKIGV
EDVEILKRARNNNKDAINIYKQFGKHLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAM
WDEIKTFAFTQSAKKIKIEWSETEGDFQVFGAAAVYLDRSSNL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtggttggtgttgatatcggtggcactaaagtgaatgctggtagggtatgtggagaaaat
ctattagactcttacttgagcaaaattccaccagatgcagaacataatgctcaatctgtt
attgatgttgtcataaatactatagcaaaagttttcacctctgaagtagaaggtattggc
gttgggattcctagtgttgcagatcgagaaaagggaattgtatatgatgtgcaaaatatc
aaatcatggcaagagattcatctaaaggaaatactagaggcagaatttaaagtaccagtt
tttatagataatgatgcaaactgttttgctattggacaaagactatatggtaaaggcaaa
caatatgaaaattttgttggtattacaataggtactggtattggtggaggaattataaat
aaaggctccttactaaaagactctaattgcggtgctggagaatttggcatgttgccatat
ctagatggaattttagaagattattgtagtggtcaattttttataaaaaagattggtgtt
gaagatgttgagattctcaagcgtgcaagaaataataataaagatgctataaatatctat
aaacaatttggtaaacatcttggagtagcaataaagtctattatgtatactctagaccca
gaagtgataataatcgcagggtcaataatatcagccagagagttttttgaaaaagcaatg
tgggatgagattaaaacatttgcctttactcaatcagctaaaaaaattaaaatagaatgg
tcagaaacggagggagattttcaggtttttggcgctgcagctgtttatttggatagaagt
agcaatttataa

DBGET integrated database retrieval system