KEGG   Francisella tularensis subsp. tularensis FSC 198: FTF1552Help
Entry
FTF1552           CDS       T00381                                 

Gene name
ole1
Definition
Delta 9 acyl-lipid fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ftf  Francisella tularensis subsp. tularensis FSC 198
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ftf01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ftf01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1612980..1613807
Genome map
AA seq 275 aa AA seqDB search
METQSNKLTIVAFAIMHLACLAIFFVNYNITALVVFVVTFSARTFALTAGYHRYFAHKAF
QTSRVFQFILALVGTWASQKGPLWWSGHHRYHHIHSDKDTDLHSPKNGIFQSHVGWVFES
RSDHVDPKFTKDWVKYPELVWIDKYAHVSFALYLVGLFALGSLISHFYPSLETSGLAFVF
WGGILSTVLLYHTTFSVNSICHIFGSKDYETDNSCNNWFIALITFGEGWHNNHHKFAYSV
RNNLKVWQIDITYMILCVLRKFRIVWDFKQPKKTI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacagtctaataaattgacaatagtagcatttgctattatgcacttagcctgc
ttggcaatattttttgtaaattataatattacagctctagttgtatttgttgttacattc
tcagctagaacatttgctttgacagctggataccatcgttactttgcacacaaagctttt
caaacctctagagtgtttcaatttatcttagcgttagtaggtacttgggcatcgcaaaaa
ggaccgctttggtggtcaggacatcatagatatcatcatatccattctgataaagataca
gacctacactcgcctaaaaatggtatctttcaatcacacgtaggctgggtttttgaatct
agaagtgatcatgttgatcctaaatttactaaagactgggttaagtatcctgagctagta
tggatagataaatatgctcatgtatcatttgctctatatctggtagggctttttgcttta
gggagcctaattagccacttttatccaagccttgaaacatctggactagcatttgtcttc
tggggagggatattaagtaccgtcttactatatcatactacttttagtgtaaactcaatt
tgccatatctttggatctaaagattacgaaacagataatagctgcaacaattggtttata
gctctaattacatttggtgaaggttggcataataatcatcataaatttgcttattcggtt
agaaataatcttaaagtatggcaaatagacattacctatatgattttatgcgtcttgaga
aagttcagaatagtttgggattttaagcaaccgaagaaaactatttag

DBGET integrated database retrieval system