KEGG   Francisella tularensis subsp. tularensis FSC 198: FTF1665Help
Entry
FTF1665           CDS       T00381                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ftf  Francisella tularensis subsp. tularensis FSC 198
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ftf00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ftf00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1733486..1734406
Genome map
AA seq 306 aa AA seqDB search
MLSFQKLLRGDQITKDDLFKLFHQADIYKNKLANSEPIKDLEGKILASLFFEPSTRTRFS
FESAMNRLGGKVISLENGSSSSTQKGETLDDTGRMIDQYADIIVMRHPKPHSVEEFSKYV
NSPVINAGDGENEHPTQSLVDLYTIYSEKGSLDNLKVGFLGDLKYGRTVHSLTNILAKYN
ASFKFISSKELQIPKKLKDFIIKNGNSFIELDKVSADVLEDLDVLYVTRVQRERFPDEES
YLKNKDLCYLDRKHISPRSNFIILHPLPRVDEMDRSIDELECAKYFEQIKYSIPIRMTLL
ALLVIS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctatcatttcaaaagttactacgcggtgatcaaattactaaagatgatttgtttaaa
ctatttcatcaagctgatatttataaaaataaactagctaattcagagcctatcaaagat
ttagaaggcaaaatattagcatctcttttctttgaaccaagcactagaactagattctct
tttgaatctgctatgaatagacttggtggtaaagtaatatcactagaaaatggctcatca
agctcaacacaaaaaggtgaaacccttgatgatacaggtagaatgattgatcaatatgct
gatattatcgtgatgcgtcaccctaaaccacatagtgttgaagagttctctaaatatgtc
aactctcctgtgataaatgctggcgatggtgaaaatgaacatcccactcagtcattggtt
gacttatatactatctactctgagaaaggctctcttgataatctaaaagttggtttctta
ggagatctaaaatatggtcgtacggttcactcactaaccaatatccttgctaaatataac
gcctcgtttaaatttatatcttcaaaagagctacagattcctaagaaactaaaagatttt
atcatcaaaaatggcaactcttttattgagttagataaagttagtgccgatgttttagaa
gacttagatgtactatatgtaactcgcgtccagagagaaaggtttcctgatgaagaaagc
tatctaaaaaataaagatttatgctatttagatagaaagcatatttcccctagaagtaat
tttataattcttcatcctctacctagagttgatgagatggatagatctattgatgagctt
gagtgtgcgaaatattttgagcaaatcaaatatagtattccgattaggatgacgctattg
gctttattagtaatatcctaa

DBGET integrated database retrieval system