KEGG   Francisella tularensis subsp. tularensis FSC 198: FTF1767cHelp
Entry
FTF1767c          CDS       T00381                                 

Gene name
purT
Definition
phosphoribosylglycinamide formyltransferase 2
Orthology
K08289  
phosphoribosylglycinamide formyltransferase 2 [EC:2.1.2.2]
Organism
ftf  Francisella tularensis subsp. tularensis FSC 198
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ftf00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ftf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1853913..1855073)
Genome map
AA seq 386 aa AA seqDB search
MNISNIKIMLLGSGELGKEFIIAAQRLGIHTIVVDRYKNAPAMQVAHESYVIDMLNSDAL
EQLILAKNPTYIVPEIEAINTDSLVKLEAHNFNIIPCAKAAKLTMDRQGIRALAAQQLNL
QTSKFAFANSEQEYLDVIQSIGLPFVIKPVMSSSGKGQSIVKEHNEIKKAWDYAQNGSRG
HAKGVIVEQFIDFDYEITLLTVRHKDGTSFCDPIGHIQKDGDYRFSWQPHTMPDTALAKS
QEIAKEITDALGGYGVFGVELFIKGDEVFFNEVSPRPHDTGMVTLISQNINEFELHLRAI
VGLPIPDIQTLQPSASAAILLEGDTANASICGIDKALADANVDIRIFGKKEIHGKRRMGV
VLAKAQNTHIALETSKQALAHIHLTK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttctaatatcaaaattatgttgcttggttcaggtgaactaggcaaagaattc
ataatagctgctcaaagacttggtatacacactatagttgtagatcgatataaaaatgca
ccagctatgcaagtagctcacgaaagctatgttatagatatgctaaattcagatgctctt
gagcaactaattctagcaaaaaatccaacgtatatagttcctgaaattgaagctataaat
accgatagcttagtaaaactagaagctcataacttcaatattatcccatgtgcaaaagcc
gcgaaactaactatggatcgccagggtataagagctttagctgcacaacagcttaattta
caaacatcaaaatttgcatttgcaaatagcgagcaggaatatctagatgtaatacaatcg
attggtctaccatttgtgattaagcctgtaatgagctcttcaggtaaaggtcaatcaatt
gttaaagaacataatgaaattaaaaaagcttgggattatgctcaaaatggctctcgaggc
catgctaaaggtgtaattgtagaacaatttatagattttgactatgagataacgctacta
actgttagacataaagatggtacttcattttgcgaccctattggacatatccaaaaagat
ggtgattatcgcttctcttggcaacctcatacaatgccagatacggctttagcaaagtca
caagaaattgctaaagaaatcaccgatgcattaggtggctatggagtttttggagttgag
ttattcataaaaggtgatgaggtattttttaatgaagtctcacctcgtcctcatgacacg
gggatggtgacacttatatctcaaaatatcaacgaatttgagctacatcttcgtgcaata
gttggactacctatacctgatatacagacattacagccatctgcttctgcagcaatatta
cttgaaggagatactgctaacgcaagtatttgcggtattgataaagcattagctgatgca
aatgtagatataagaatatttggcaaaaaagaaatacatggtaaacgccgtatgggagtt
gtcttagcaaaagcacaaaatactcacatagctttagaaacttctaagcaagctctagca
catattcatcttactaaataa

DBGET integrated database retrieval system