KEGG   Francisella tularensis subsp. tularensis FSC198: FTF1795cHelp
Entry
FTF1795c          CDS       T00381                                 

Gene name
trpC
Definition
(GenBank) tryptophan biosynthesis protein
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
Pathway
ftf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ftf01100  Metabolic pathways
ftf01110  Biosynthesis of secondary metabolites
ftf01130  Biosynthesis of antibiotics
ftf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftf00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTF1795c (trpC)
Enzymes [BR:ftf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     FTF1795c (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     FTF1795c (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAL09811
Position
complement(1882853..1884214)
Genome map
AA seq 453 aa AA seqDB search
METILAKIVEAKRKWLFAKKRLFPLDVFKKEVVKTDRDFYQALESDKAVFILECKKGSPS
KGIIRKKFDLNEIAAVYKNYANVISVLTDEEFFMGSFANLEIVRKQVTQPMLCKDFIIDE
YQIFLARHYQADAVLLMLSVLDDSEYKKLAKVANRLGMGILTEVSNEEELVRAISLKAKV
IGINNRNLRDLSIDLNTTRLLAPKIPKGTIIISESGIYKNQEIRDLRNYVNGFLIGSSIM
GERNLELAVRKLVYGFNKVCGLTSVEDAQKAYDAGAVYGGLIFVEKSPRYVDFAMAKQIV
KKVRLNYVGVFADAKIEDVVDTCYALKLSAVQLHGDENQEYIDTLKSKLYRNCQIWKAYP
VDKTLPSFFANVDYHLLDAQVDGKSGGTGKTFDWSLIKDRKNIILAGGLNAKNIAKAIEL
KCSAYDINSGVESEPGQKDQIKLNEVFEIIRSY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattttagcaaaaatcgttgaagcaaaaagaaagtggctttttgcaaaaaaa
agactatttccactagatgtatttaaaaaagaagttgtcaaaacagatagagatttctat
caagctttggaatctgataaagctgtatttattttagaatgtaaaaaaggctctccttct
aaaggaattattcgtaaaaagtttgatctaaatgaaattgcagctgtatacaaaaattat
gcaaatgtgatatctgtacttacagatgaagaattttttatgggtagctttgcaaatcta
gagattgttagaaagcaagtaacacaacctatgctttgtaaagattttataatagatgaa
tatcaaatattcttagctaggcattatcaagctgatgctgtgttacttatgctttcagta
cttgatgatagtgagtataaaaaattagcaaaagttgctaatcgtctaggtatgggtata
ttaaccgaagttagtaacgaagaagagcttgtaagagctataagcttaaaagcaaaagtt
ataggtattaataatcgtaatctaagagatctttctatagatttaaatactacgcgtctt
ttagctccgaaaatacctaaaggaacaattattatttcagaatcagggatctataaaaat
caagaaatacgtgatctaagaaattatgtaaatggctttttgataggaagttctattatg
ggtgaacgtaaccttgaacttgcagttagaaagcttgtttatggttttaataaggtttgc
ggccttacttctgttgaggatgctcaaaaagcatatgatgcaggagcagtctatggtggt
ttgatttttgttgagaaatctcctcgttatgtagattttgccatggcaaaacagatagta
aaaaaagttaggctaaattatgtaggtgtttttgctgacgctaaaatagaagatgttgta
gatacctgctatgcattaaaattaagtgctgtgcagttgcatggtgatgaaaatcaagag
tatatagatactctaaaatcaaagctatatagaaactgtcaaatatggaaagcatatcca
gtagataagactcttccaagtttttttgctaacgtagattatcatttattagatgcccaa
gtagatggtaaatcaggtggtacaggaaaaacatttgattggagtcttatcaaagacaga
aaaaatataattcttgctggcggtctgaatgctaaaaatatagcaaaagcaatagaattg
aagtgttcagcttatgatattaattctggtgtagaatctgaaccaggacaaaaagatcaa
atcaaactaaatgaagtatttgaaataattagaagttattaa

DBGET integrated database retrieval system