KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_0069Help
Entry
FTU_0069          CDS       T01762                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
Pathway
ftg00020  Citrate cycle (TCA cycle)
ftg00190  Oxidative phosphorylation
ftg00650  Butanoate metabolism
ftg01100  Metabolic pathways
ftg01110  Biosynthesis of secondary metabolites
ftg01120  Microbial metabolism in diverse environments
ftg01130  Biosynthesis of antibiotics
ftg01200  Carbon metabolism
Module
ftg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ftg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ftg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FTU_0069 (sdhD)
   00650 Butanoate metabolism
    FTU_0069 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    FTU_0069 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DoxX
Motif
Other DBs
NCBI-ProteinID: AFB78209
Position
74282..74650
Genome map
AA seq 122 aa AA seqDB search
MGVLLMAVISLTSSGIKDFFVQRVTAVIIAVYFGYLILEALYLSHIGALNYDSWRGLFTD
GMFFRVATLMAYLAMFFHAWVGIWIICGDYIKFAWASALVMLSFVLVYIFCFFWLFAVLF
FY
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgttacttatggctgtaatttcattaacttcttctggaattaaagactttttc
gtacaaagagttacggctgtaattattgctgtatattttggttatcttatcctagaagct
ttgtatttgtcgcatataggagctcttaactatgatagttggagaggtttgtttaccgat
gggatgttttttagagttgctacgttaatggcgtacttggcgatgttttttcatgcatgg
gtaggtatctggattatatgtggcgattatattaaatttgcttgggcttctgcgcttgtg
atgctgagctttgttttggtgtatatattctgctttttttggttatttgcagttttattt
ttctattaa

DBGET integrated database retrieval system