KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_0073Help
Entry
FTU_0073          CDS       T01762                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
Pathway
ftg00020  Citrate cycle (TCA cycle)
ftg00310  Lysine degradation
ftg01100  Metabolic pathways
ftg01110  Biosynthesis of secondary metabolites
ftg01120  Microbial metabolism in diverse environments
ftg01130  Biosynthesis of antibiotics
ftg01200  Carbon metabolism
Module
ftg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ftg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FTU_0073 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    FTU_0073 (sucB)
Enzymes [BR:ftg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FTU_0073 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 E3_binding RnfC_N QRPTase_N T2SSB GCV_H
Motif
Other DBs
NCBI-ProteinID: AFB78213
Position
80044..81513
Genome map
AA seq 489 aa AA seqDB search
MVELKVPMFPESVADGTLAQWNKNEGDFVNEGDILAEIETDKVVLEVPATSSGVLKGIKK
HAGDTVLSEESLAIIDTAVSTSEPNQQTTNQGNASEATATGQEIDIKAPVFPESVADGTI
SEWHKKEGEAVSEGDILAEIETDKVVLEVPATSNGVLTKILKTAGETVLSAELIAKITAG
GATATTKSEASVGVSQANNDPHLVPSARKAFNASGLDTAANIEGTGKKGRITSEDVKKAV
ASVNKPQQQTVVINQGARYEKRVKMTRLRQTIANRLVEVQHTNAILTTFNEVDMSAVMEL
RNKYKDMFVKEHDTKLGFMSFFIKAATEALKKFPDVNASIDGDEIVYHNYFDIGIAVGTD
RGLVVPVLRDTDTKSLAELEADVLDKAIKGRDGKLSLEDMQGGTFTITNGGTYGSMLSTP
IINSPQSAILGMHNIVERPVVVKGEIKIRPIMYLALSYDHRIIDGGTSVRFLKMIKELIE
DPNRILLQV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggttgaattaaaagtacctatgttcccagagtctgtagcagatggcacattagctcaa
tggaataaaaacgaaggtgactttgtaaatgagggcgatatcttggcagagattgagact
gataaagttgttctagaagtacctgcaacatctagtggtgttttaaaagggataaaaaaa
catgctggtgatacagtgctttcagaagagtcattagcgatcattgatactgctgtttct
acatctgaacctaaccaacaaactactaatcaaggaaatgcttcagaagcaactgctact
gggcaagaaattgatattaaggcgcctgtatttccagagtctgtagcagatggcacgatc
tcagagtggcataagaaagagggtgaggctgtttctgagggtgatatcttagcagagatt
gagactgataaggttgttctagaggttccggcaacatcaaatggtgttttgacaaaaata
ttaaaaacagcaggagagactgtactatctgcagagcttatcgctaagattacagcagga
ggcgcaactgctactacgaaatcagaagcttcggtgggagtttctcaagcaaataatgat
ccgcatctagtaccttcagcacgtaaagcttttaatgcaagcggcttggatactgctgct
aatatcgaaggtacaggtaaaaaagggcgtataacttctgaagatgtcaaaaaagcagtt
gcatcagtaaataaacctcaacaacagacagttgttataaatcaaggtgctagatatgaa
aaaagagtcaagatgactcgtctgcgtcagactatagcaaataggttagttgaggttcaa
catactaatgcaatcttaactactttcaatgaagtagatatgagtgcagttatggagctt
agaaacaaatataaagatatgtttgtcaaagaacatgatactaagcttggctttatgtct
ttctttatcaaagcagcaacagaagcacttaagaaattcccagatgtaaatgcctctatt
gatggtgatgagattgtttaccataattattttgatattggtattgctgtaggtactgat
aggggtctagtggtacctgtactaagagatacagatactaaatctctagctgaattagaa
gccgatgttttagacaaagcgattaaaggtcgtgatggtaaattaagccttgaagatatg
caaggtggtacatttacgattacaaatggcggaacttatggttcgatgttatctacgcct
attattaattcaccgcaaagtgctattttaggtatgcataatattgttgagcgtcctgta
gttgttaagggtgagattaagattcgtccaattatgtatttagcgttatcttacgaccat
agaatcattgatggcggtacatctgtaagattcttgaagatgatcaaagagctaattgaa
gatccaaatagaattcttctacaagtatag

DBGET integrated database retrieval system