KEGG   Francisella tularensis TIGB03: FTU_0361Help
Entry
FTU_0361          CDS       T01762                                 

Gene name
holC2
Definition
DNA polymerase III (CHI subunit) protein (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ftg  Francisella tularensis TIGB03
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ftg00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ftg00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ftg03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ftg03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ftg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
387633..388073
Genome map
AA seq 146 aa AA seqDB search
MMKIEFKVLQTQDINQMLEVLITEVVKEYALQKTIAILAPAGIAKQLDDKLWQDGQDSFI
PHHCAINAREYNQYNNIPILITDNLFITSGYDVLINIMDVAVDPQRVKVKELKEFVYQQD
SALQASRKKYVYYKKSNLEIITVQDN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaatagagtttaaggttttgcagacacaagatattaatcaaatgctagaagtg
ctgattactgaagttgtcaaagaatatgctttacaaaagacaattgcaatcttagcacca
gcaggtattgcaaaacaactagatgataaactatggcaagatggtcaagattcttttatc
ccacatcattgtgctataaatgctagagagtataatcaatataataatattccaattctt
atcacagataatctatttattacctcaggttatgatgttttaataaatattatggatgtg
gctgtagacccacagcgagttaaagtcaaagagctaaaagagtttgtctatcaacaagat
agcgctttacaggcttcacgtaagaagtatgtttactacaaaaaatcaaatctagagata
attactgttcaagataactaa

DBGET integrated database retrieval system