KEGG   Francisella tularensis TIGB03: FTU_0374Help
Entry
FTU_0374          CDS       T01762                                 

Gene name
folA2
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ftg  Francisella tularensis TIGB03
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FTU_0374 (folA2)
   00670 One carbon pool by folate
    FTU_0374 (folA2)
Enzymes [BR:ftg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     FTU_0374 (folA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(403581..404123)
Genome map
AA seq 180 aa AA seqDB search
MLKYIKMTKNRFLKMISLIVAYDKNFGIGKENTLAWKLSEDLKNFKKITENNYIVMGRKT
FESIGRPLPNRKNIILTRDKDYKQDKCLIINSTQDILNFAESKPHYEIFIIGGAQIYKEF
LKYADRLYITEVDAEMTDLDAFFPQWDKSKYKRIGHKQFKKDDKNEFDFTFSVFEKNKNL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaatacatcaaaatgactaaaaatagatttctcaaaatgatctcactaatcgtt
gcttatgataaaaactttggtataggtaaagaaaatactctagcatggaaactatcagaa
gatcttaagaactttaaaaaaataacagaaaacaactatattgttatgggtagaaaaacc
tttgaatcgattggtcgcccactaccgaatcgtaaaaatattattttaactagagacaaa
gattacaaacaagataaatgtttaataataaatagtactcaggatattttaaattttgct
gaatcaaaaccacactacgaaatatttataatcggtggtgcacagatctataaagaattt
ctaaaatacgcagatagattgtatataaccgaagttgatgcagaaatgactgatcttgat
gctttctttccacaatgggataaatcaaaatataaacgtattggtcacaaacaattcaaa
aaagatgataaaaatgagtttgactttacatttagcgtctttgaaaaaaataaaaatttg
taa

DBGET integrated database retrieval system