KEGG   Francisella tularensis TIGB03: FTU_0481Help
Entry
FTU_0481          CDS       T01762                                 

Gene name
thrC1
Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ftg  Francisella tularensis TIGB03
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FTU_0481 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTU_0481 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FTU_0481 (thrC1)
Enzymes [BR:ftg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FTU_0481 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
518952..520238
Genome map
AA seq 428 aa AA seqDB search
MNFISTRDKNIKVSLSEAMQSGLAPDGGLFVLERFPTVNWQSFAKDISYAKFAANTLREF
FKGDQLEDSLDKICNNAFTFEVPVRRLDKTTSVLELFHGPTLSFKDFGARFLANCLSSID
SEKPFTILVATSGDTGSAVAAAFHGKSNIRVIVMFPKGKISKRQEKQITCWGDNIQAVEV
EGVFDDCQSLVKEAFKTPWWTERTKLNTSNSINIGRLLPQSTYYAYTSWQHYLQTGEKAN
YIVPSGNIGNITAAFWAKQMGFPIGEISMSLNANDTVVDYLETGKFNPKASVETLANAMD
VGNPNNFERLLYLLGNYENFKANVKAICVSDFEIIEEIKQVYRQYHEVVCPHTATGFVAK
NQLDSNKDYIIVATAHPAKFESVIEPILDIQVPPTPALQKLLDKEQNKVVINKSMDELCE
VYTKAFEA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattagtactagagataaaaatattaaagtttcactaagtgaagcgatgcag
tctggattagctcctgatggaggattatttgtcctagagagatttcctacagttaattgg
cagagttttgctaaagatatcagttacgcgaagtttgctgctaatactctaagagaattc
tttaaaggagatcagctagaagactctttagataaaatttgtaataatgcttttactttt
gaggttcctgtaagaagattagataaaaccacatcagttttagagctttttcatggtcca
actttatcttttaaagatttcggtgcgagatttttagcaaactgtttaagctctatcgat
agtgagaagccatttactattttagtggcaacttctggagatacgggttcagcagtagct
gcagcttttcatggtaagagcaatatccgtgttatagtgatgtttcctaaaggtaaaatc
tctaaaagacaagaaaagcagataacttgttggggagataatatccaagcagttgaagtt
gaaggagtttttgatgactgtcaaagtctagtcaaagaagcttttaagacaccttggtgg
acagagaggactaagttaaatacatcaaatagtattaatatcggtagattactaccacaa
tcaacttattatgcttatacatcgtggcaacattatttgcagaccggagagaaagcaaac
tatatagttccatctggcaatattggtaatataactgctgctttttgggcaaagcaaatg
ggctttccaataggtgaaatatcgatgagtttaaatgctaatgatactgttgttgactat
ctagagactggtaagtttaatcctaaggcaagtgttgaaacgctagcaaatgctatggat
gttggtaaccctaataattttgaaagattgttatacttgttgggtaattatgaaaatttc
aaagctaatgttaaggctatatgtgtttctgactttgaaattatagaagaaataaaacaa
gtgtatcgtcaatatcatgaagttgtttgtccacacacagcaacaggttttgtagcaaaa
aatcagttagatagcaataaagattatataatcgtagcaactgcacatcctgctaagttt
gaaagtgtaattgagcctatattagatatacaagtgccgcctacaccggcgttacaaaag
ctactagacaaagagcaaaataaagtagttataaataagtctatggatgagctgtgcgag
gtttatacaaaagcttttgaagcttag

DBGET integrated database retrieval system