KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_0481Help
Entry
FTU_0481          CDS       T01762                                 

Gene name
thrC1
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
Pathway
ftg00260  Glycine, serine and threonine metabolism
ftg00750  Vitamin B6 metabolism
ftg01100  Metabolic pathways
ftg01110  Biosynthesis of secondary metabolites
ftg01120  Microbial metabolism in diverse environments
ftg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTU_0481 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FTU_0481 (thrC1)
Enzymes [BR:ftg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FTU_0481 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N IL6
Motif
Other DBs
NCBI-ProteinID: AFB78590
Position
518952..520238
Genome map
AA seq 428 aa AA seqDB search
MNFISTRDKNIKVSLSEAMQSGLAPDGGLFVLERFPTVNWQSFAKDISYAKFAANTLREF
FKGDQLEDSLDKICNNAFTFEVPVRRLDKTTSVLELFHGPTLSFKDFGARFLANCLSSID
SEKPFTILVATSGDTGSAVAAAFHGKSNIRVIVMFPKGKISKRQEKQITCWGDNIQAVEV
EGVFDDCQSLVKEAFKTPWWTERTKLNTSNSINIGRLLPQSTYYAYTSWQHYLQTGEKAN
YIVPSGNIGNITAAFWAKQMGFPIGEISMSLNANDTVVDYLETGKFNPKASVETLANAMD
VGNPNNFERLLYLLGNYENFKANVKAICVSDFEIIEEIKQVYRQYHEVVCPHTATGFVAK
NQLDSNKDYIIVATAHPAKFESVIEPILDIQVPPTPALQKLLDKEQNKVVINKSMDELCE
VYTKAFEA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattagtactagagataaaaatattaaagtttcactaagtgaagcgatgcag
tctggattagctcctgatggaggattatttgtcctagagagatttcctacagttaattgg
cagagttttgctaaagatatcagttacgcgaagtttgctgctaatactctaagagaattc
tttaaaggagatcagctagaagactctttagataaaatttgtaataatgcttttactttt
gaggttcctgtaagaagattagataaaaccacatcagttttagagctttttcatggtcca
actttatcttttaaagatttcggtgcgagatttttagcaaactgtttaagctctatcgat
agtgagaagccatttactattttagtggcaacttctggagatacgggttcagcagtagct
gcagcttttcatggtaagagcaatatccgtgttatagtgatgtttcctaaaggtaaaatc
tctaaaagacaagaaaagcagataacttgttggggagataatatccaagcagttgaagtt
gaaggagtttttgatgactgtcaaagtctagtcaaagaagcttttaagacaccttggtgg
acagagaggactaagttaaatacatcaaatagtattaatatcggtagattactaccacaa
tcaacttattatgcttatacatcgtggcaacattatttgcagaccggagagaaagcaaac
tatatagttccatctggcaatattggtaatataactgctgctttttgggcaaagcaaatg
ggctttccaataggtgaaatatcgatgagtttaaatgctaatgatactgttgttgactat
ctagagactggtaagtttaatcctaaggcaagtgttgaaacgctagcaaatgctatggat
gttggtaaccctaataattttgaaagattgttatacttgttgggtaattatgaaaatttc
aaagctaatgttaaggctatatgtgtttctgactttgaaattatagaagaaataaaacaa
gtgtatcgtcaatatcatgaagttgtttgtccacacacagcaacaggttttgtagcaaaa
aatcagttagatagcaataaagattatataatcgtagcaactgcacatcctgctaagttt
gaaagtgtaattgagcctatattagatatacaagtgccgcctacaccggcgttacaaaag
ctactagacaaagagcaaaataaagtagttataaataagtctatggatgagctgtgcgag
gtttatacaaaagcttttgaagcttag

DBGET integrated database retrieval system