KEGG   Francisella tularensis TIGB03: FTU_0482Help
Entry
FTU_0482          CDS       T01762                                 

Gene name
ebgA
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ftg  Francisella tularensis TIGB03
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FTU_0482 (ebgA)
Enzymes [BR:ftg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     FTU_0482 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(520339..520569)
Genome map
AA seq 76 aa AA seqDB search
MYFGVDYYPEQWDYSLINEDLNRIANSELNCIRIAEFAWHLMEPIENEFDFSFFEMILNK
AHKLGLKVMLGTPIAT
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgtattttggtgtcgactattacccagaacaatgggattattctcttattaatgaagat
ttaaatcgtatagcaaattctgagttaaattgtattagaattgctgaatttgcttggcat
ctaatggagcctatagaaaatgaatttgattttagtttctttgaaatgatactaaataaa
gctcataagttaggattaaaagttatgttaggaacccctatagcaacttag

DBGET integrated database retrieval system