KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_0970Help
Entry
FTU_0970          CDS       T01762                                 

Definition
(GenBank) putative sugar kinase ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
Pathway
ftg00010  Glycolysis / Gluconeogenesis
ftg00052  Galactose metabolism
ftg00500  Starch and sucrose metabolism
ftg00520  Amino sugar and nucleotide sugar metabolism
ftg00521  Streptomycin biosynthesis
ftg01100  Metabolic pathways
ftg01110  Biosynthesis of secondary metabolites
ftg01120  Microbial metabolism in diverse environments
ftg01130  Biosynthesis of antibiotics
ftg01200  Carbon metabolism
Module
ftg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTU_0970
   00052 Galactose metabolism
    FTU_0970
   00500 Starch and sucrose metabolism
    FTU_0970
   00520 Amino sugar and nucleotide sugar metabolism
    FTU_0970
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FTU_0970
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FTU_0970
Enzymes [BR:ftg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FTU_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK IF2_N
Motif
Other DBs
NCBI-ProteinID: AFB79025
Position
1020009..1020860
Genome map
AA seq 283 aa AA seqDB search
MVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEVEGIG
VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK
QYENFVGITIGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYCSGQFFIKKIGV
EDVEILKRARNNNKDAINIYKQFGKHLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAM
WDEIKTFAFTQSAKKIKIEWSETEGDFQVFGAAAVYLDRSSNL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtggttggtgttgatatcggtggcactaaagtgaatgctggtagggtatgtggagaaaat
ctattagactcttacttgagcaaaattccaccagatgcagaacataatgctcaatctgtt
attgatgttgtcataaatactatagcaaaagttttcacctctgaagtagaaggtattggc
gttgggattcctagtgttgcagatcgagaaaagggaattgtatatgatgtgcaaaatatc
aaatcatggcaagagattcatctaaaggaaatactagaggcagaatttaaagtaccagtt
tttatagataatgatgcaaactgttttgctattggacaaagactatatggtaaaggcaaa
caatatgaaaattttgttggtattacaataggtactggtattggtggaggaattataaat
aaaggctccttactaaaagactctaattgcggtgctggagaatttggcatgttgccatat
ctagatggaattttagaagattattgtagtggtcaattttttataaaaaagattggtgtt
gaagatgttgagattctcaagcgtgcaagaaataataataaagatgctataaatatctat
aaacaatttggtaaacatcttggagtagcaataaagtctattatgtatactctagaccca
gaagtgataataatcgcagggtcaataatatcagccagagagttttttgaaaaagcaatg
tgggatgagattaaaacatttgcctttactcaatcagctaaaaaaattaaaatagaatgg
tcagaaacggagggagattttcaggtttttggcgctgcagctgtttatttggatagaagt
agcaatttataa

DBGET integrated database retrieval system