KEGG   Francisella tularensis TIGB03: FTU_0990Help
Entry
FTU_0990          CDS       T01762                                 

Gene name
folE
Definition
GTP cyclohydrolase I type 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ftg  Francisella tularensis TIGB03
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ftg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1039304..1039921)
Genome map
AA seq 205 aa AA seqDB search
MMKDKYCSKLGKSVQEHLIKLGLEQPREFNLDNDNKITIITKAYRQILDALGLYTDEFEK
TPFRVARMFTQEIFNGLDYANFPACALYENEFNYTGVLTQKNITIMSFCEHHFVPFEGTA
EVSFIPKNNNIIGLCRINSICDFFSRRPQIQERMTAQIFEALKFILSTEDVSVKIKAKHA
CVSLRGVNNQNSQTYTQMVGGVFAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagataaatattgctctaaattaggtaaaagtgtccaagaacatctcatcaag
ttaggtttagagcaacctagagaatttaaccttgataatgataataaaataaccataatc
accaaagcataccgacaaatcttagatgctctcggcttatacacagatgaatttgaaaaa
actccatttagagtagcgaggatgtttactcaagaaatatttaatggacttgattatgct
aatttccctgcttgtgctttatacgagaacgagtttaactatactggtgtgctaactcaa
aaaaatataactataatgtcattttgtgagcaccattttgtaccttttgaaggtactgca
gaagtttcttttattcctaaaaataataatattatagggctttgtcgtataaatagcatt
tgtgactttttttccagacgcccacaaatacaagaaagaatgaccgctcaaatatttgag
gccttaaaattcattttatcgacagaagatgttagtgtgaaaattaaggcaaaacatgct
tgtgtctcacttagaggggtaaataatcaaaattctcaaacatatacacaaatggttggt
ggagtttttgctaaataa

DBGET integrated database retrieval system