KEGG   Francisella tularensis TIGB03: FTU_1322Help
Entry
FTU_1322          CDS       T01762                                 

Gene name
glk1
Definition
putative kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ftg  Francisella tularensis TIGB03
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FTU_1322 (glk1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTU_1322 (glk1)
   00052 Galactose metabolism
    FTU_1322 (glk1)
   00500 Starch and sucrose metabolism
    FTU_1322 (glk1)
   00520 Amino sugar and nucleotide sugar metabolism
    FTU_1322 (glk1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FTU_1322 (glk1)
   00524 Butirosin and neomycin biosynthesis
    FTU_1322 (glk1)
Enzymes [BR:ftg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FTU_1322 (glk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1395289..1396305)
Genome map
AA seq 338 aa AA seqDB search
MYILSGDIGGTNTRLEVSLLENGATQSIAIRKYKGANFNCLSDIIDKFLSEVDLVGQIDS
VCLAVAGFVSNGEVEVTNLPWMVSEQYISEGLGIDKTKVKVINDFEAIGYGIESLDREKD
IITIQEGKKDDDNLCAVVGAGTGLGMCLVSYDKDDKPRVYKTEGGHVDFSPVDDEQVELF
KFMRKTFHRISPERFCSGYGIYNIYKYVVRHPLYDQPECMELRRALFSVSDSDKAAVIVK
YAIEHREPSALRTIDIFLSIYGSVAGNLALTSLPFRGLYIAGGIAPRLIKQIKESKFLEK
FRDKGRMSNMMKDFPVHIIMNTDVGLIGARTYAAGLVK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtatatattatcaggagatattggtggcactaacactagattagaggtttctctttta
gagaatggtgcgacacaaagtatagctataagaaagtataaaggtgcgaatttcaattgt
ttatctgatattattgataagtttttatctgaggtggacttagtaggtcaaatagattct
gtttgtcttgcagtagctggatttgtctctaatggtgaagttgaagtgactaatctgcca
tggatggtttctgagcaatatatctcagaaggacttggtatagacaaaactaaggttaaa
gtgattaatgactttgaagcaattggttatggtatagaatctctagatagagaaaaagat
ataatcacaatccaggaaggtaaaaaagatgatgataacttatgtgctgtagttggtgct
ggtacaggtttgggaatgtgtttagttagctatgataaagacgataagccaagagtttat
aaaacagaaggaggtcatgtggatttctcacctgttgatgatgaacaagttgagttattt
aagtttatgcgtaagactttccatcgtatctctcctgagagattctgtagcggctacggc
atttacaatatttataagtatgtggtgcgtcatcctttatatgatcaacctgaatgtatg
gagttacgtagagcattatttagtgtttcagactctgataaggcagcagtaattgttaag
tatgctattgagcatagagagccatcagcattaaggacgatagatatattcttaagtata
tatggctcagttgctggtaatttagcacttacaagtttaccttttagaggtctttatatt
gctggaggtattgcacctaggctcatcaagcaaataaaggagagtaaattcttagagaag
tttagagataaaggtagaatgtcaaacatgatgaaagattttccagtgcatataattatg
aacacagatgtcggtttaataggcgcgcgtacgtatgctgctgggctagtaaagtaa

DBGET integrated database retrieval system