KEGG   Francisella tularensis TIGB03: FTU_1416Help
Entry
FTU_1416          CDS       T01762                                 

Gene name
recD
Definition
Exodeoxyribonuclease V alpha chain (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ftg  Francisella tularensis TIGB03
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FTU_1416 (recD)
Enzymes [BR:ftg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FTU_1416 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1512736..1514577)
Genome map
AA seq 613 aa AA seqDB search
MYKTFHKACEQLADIRAIDFFFAKEVFGLVKKTTPSMTTLSSESYPPFHGAKGNDLEQKS
NEILFHILMKLMHVYSHGHSCLKIADISNKTIFASEQSNQSDAKVGFKMPSSDKIASILD
NLNYDNLPIYFAKQYDSLYIKRLWNYENEIANFIKLKTIQNTQKDNRIEEVVDKLFEPAG
EINWQKQAVIKSLNYNFSIISGGPGTGKTTTVAKLLLAIQMLNQNQQRIALLAPTGKAAQ
RMTESLKNTLATVIPSSLTTESTIQKNDIFKQVQDELNSVAQYLNNLEAQTIHRFLGLRP
NSTYVKYNQQSKAPFDVIIVDEASMLDMNIFIKLIRAVADNTKLILIGDTNQLPSVEAGS
LLANFTHDKYGSITPYTTLLIKNYRSQQYINNLAASVLKGDVNIDSQQNENIKFHSLRNL
DIYLREYAKRYSQLEKCRDYKEALTELNKFRILVANKNLEIGTDKLNQKIEKFMSKPIDS
NYKGKLIMITQNSYSLGLFNGDVGIMWPDDTGKLRAYFDGKDAKAFSLNMLPKYESVYAM
TIHKTQGSEFDEIVIILPAEDNEALSKQLLYTAITRAKYKLTIISEQSSLRDIAQKDIKR
NSNISELVSLSTQ
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaactttccataaagcttgtgagcaattagcagatattagagccatagatttt
ttctttgctaaagaggtgtttggtttagtcaaaaagactactccgtctatgaccacttta
tcaagtgagtcatatccaccctttcacggagcaaaggggaatgatttggaacaaaaaagt
aatgaaattttatttcatattttgatgaagcttatgcatgtgtatagtcatggtcatagc
tgtttgaagatagcagatatatcaaataaaactatttttgcttcagagcaaagtaatcag
agtgatgctaaagtaggctttaaaatgccaagctctgataaaattgcaagtattttagat
aacttaaattacgataatttacctatatattttgccaaacagtatgattctttgtatatt
aaaagattgtggaattatgaaaatgaaatagctaactttataaaattaaaaacaatccaa
aatactcaaaaagacaatcgtattgaagaagttgtagacaaactatttgaacctgctggt
gaaatcaactggcaaaaacaggcggttatcaaaagtctaaattataattttagtattatc
tcaggtggacctggtacaggtaagacaaccacagtcgcaaagcttttacttgctatacaa
atgcttaatcaaaatcagcaaagaatagcgcttttagcaccaactggtaaggctgctcag
agaatgacagagtcattaaaaaatactctagcaactgtcattccgtcaagcttgaccaca
gaatctactatacaaaaaaatgatatctttaaacaagttcaggatgaacttaatagtgtt
gctcagtatcttaataatctagaagcacaaactatacacagatttttaggcttaagacca
aactctacttatgttaaatataaccaacaatctaaagctccattcgatgttattattgtt
gatgaagcttcgatgcttgatatgaatatttttatcaagttaattagagctgtagcagat
aatactaagttgatattaataggtgatactaatcagttaccatctgttgaggctgggagt
cttttagcaaactttacacatgataaatatggtagcattacgccatatacaacattactt
atcaaaaactatcgttcacaacaatatataaataatcttgcagcctcagtcctaaaaggc
gatgttaatattgatagtcaacaaaatgaaaatattaaatttcatagtctaagaaattta
gatatttatttaagagagtatgcaaagagatattcacagcttgaaaagtgccgtgactac
aaagaggctcttacagagctgaataaatttagaatacttgtggctaacaaaaacctagaa
attggtacagataagttaaatcagaaaattgagaagtttatgtctaagcctatagattct
aactataagggtaaactaattatgataactcaaaatagttattcattagggttatttaat
ggagatgtagggattatgtggcctgatgatactggtaagctccgagcatattttgatggt
aaagatgctaaggcatttagtctaaatatgctaccaaaatatgaaagtgtttatgcgatg
acaattcataaaactcaaggctcagagtttgatgaaatcgtgattattcttccagcagaa
gataatgaagcgctaagtaaacaacttttgtatacagctattactagagcaaaatataaa
ttaacgattatatctgaacaaagtagcttaagagatattgctcagaaagatattaagaga
aattcaaatatcagtgaattagttagcttgagcactcaataa

DBGET integrated database retrieval system