KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_1499Help
Entry
FTU_1499          CDS       T01762                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
Pathway
ftg00010  Glycolysis / Gluconeogenesis
ftg00020  Citrate cycle (TCA cycle)
ftg00620  Pyruvate metabolism
ftg01100  Metabolic pathways
ftg01110  Biosynthesis of secondary metabolites
ftg01120  Microbial metabolism in diverse environments
ftg01130  Biosynthesis of antibiotics
ftg01200  Carbon metabolism
Module
ftg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTU_1499 (aceF)
   00020 Citrate cycle (TCA cycle)
    FTU_1499 (aceF)
   00620 Pyruvate metabolism
    FTU_1499 (aceF)
Enzymes [BR:ftg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FTU_1499 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N NQRA HlyD_3 PTS_EIIA_1 DUF2118 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AFB79507
Position
complement(1610096..1611991)
Genome map
AA seq 631 aa AA seqDB search
MSIEIVKVPDIGDYDNVDVIEVNVAVGDVIAEEDSLITLETDKASMEVPSPFAGKITKLT
VKVGDKVSQGTAIMEVEVESAADQAATTQSQPQTTSSAPVAATTNLIVDVEVPDIGDYDS
VDVIEVSVKVGDEIAEEDSLITLETYKASMEVPSPVAGKVVEVITKVGDKVSQGSLILKV
ETGSSAQAPAQEQSQQSAPVKSAAEEIIDVKVPDIGDYDSVDVIEVSVAVGDKIEEEDSL
ITLETDKASMEVPSPVAGEVVEIITKVGDKVSQGSLILKVKTQGSAPVEQTSSQPAPAKQ
EQAKQQAATPAAPTPASSSVNEYAVDNSNAHASPAVRKLARILNIDLSKVKATGRKGRVT
KEDCYNYIKHAVTQVQTGKVAASGSGLDLLDDPVVDFAKFGEIETQPLSRINKISAKNLH
RNWVKIPHVTFYDDADVTDLEEFRNAKKAFAEKKGIKITPLSFLVKAAAVALQEFPRFNS
SLSNDGENLIIKKYYNIGFAADTPAGLMVPVVKDADKKGIIEISKDIMELAGKARDGKLG
AKDMTGATFTISSLGVLGTTSFTPIINMPEVAIMGVSKTAVKPIWNGKEFIPRTMLPLSL
STDHRVIDGALAAKFLTRYCQILSDLREIIM
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagagatagttaaagtccctgatattggggattatgataacgttgatgtgatc
gaggttaatgttgctgtaggtgatgttattgctgaagaagattcactaattacgttagaa
acagataaagcaagtatggaggttccatctccatttgcaggtaagatcactaaattaact
gtaaaagttggtgataaagtttctcagggaactgcaataatggaagttgaggttgagagt
gctgctgatcaagctgctactacacaatcacaacctcaaacaactagttcagctcctgta
gctgctacgacgaacctgattgttgatgtcgaggttccagatattggcgactatgatagt
gttgatgtgattgaggtgtctgtaaaagtaggtgatgagatagcagaagaggattcgcta
attacgcttgaaacatataaggctagtatggaagtaccatcgcctgtagcgggtaaggtt
gttgaagttattactaaggttggtgacaaggtttcacaaggtagcttgattttaaaggtt
gaaacaggctctagtgcacaagctccagctcaagaacagtcacaacaatctgcaccagtt
aaatccgctgctgaagaaattattgatgtaaaagttcctgatatcggtgattacgatagt
gttgatgtgattgaagtatctgtagctgttggtgataagattgaagaagaagattctttg
attacattagaaactgataaggcaagcatggaggttccgtctccagttgctggtgaagtt
gttgaaataatcacaaaagttggtgataaagtttcacaaggtagtttaattcttaaggtc
aaaacacaaggttcagcaccggtagagcaaactagttcacaaccagcgccagctaaacaa
gagcaagctaaacagcaagctgctacacctgctgctccaacgccagcatcaagttcggta
aatgagtatgctgtagataattctaatgcacatgcgtctcctgcagtgagaaagctagca
cgaattctaaatattgatctaagtaaggttaaagctacagggcgtaaaggtcgtgtaaca
aaagaagattgttataactatattaagcatgctgtcacacaagttcaaactggtaaggtc
gctgctagtggtagtggtttagatcttttagatgatcctgttgttgattttgctaagttt
ggtgagattgaaactcaaccattatcaagaattaacaagattagtgctaagaatttacat
cgtaactgggtgaagattcctcatgttacattctatgatgatgcggatgtcacagactta
gaagagttcagaaatgctaagaaagcctttgctgagaaaaaaggtattaagattacacct
ttatcattcttggttaaagctgctgcagttgcattacaagagttcccaagatttaatagc
tcattatcaaatgatggtgagaacttaattatcaagaagtattataatattggttttgct
gcagatactccagctggtttaatggttccagttgtcaaagatgctgataaaaagggtatc
attgaaatatcaaaagatattatggagttggctggcaaagctcgtgatggtaaacttggc
gcaaaggatatgacaggtgctacatttactatctcaagcttaggcgtgttaggtactacg
tcatttacgcctattataaatatgccagaggtggctattatgggtgtatctaagacagca
gtgaagcctatttggaatggtaaagagtttattcctagaactatgctaccattatcatta
tctacagatcatagagtgatagatggcgcattagcagctaaattcttaactagatattgt
cagattttatctgatttacgtgaaatcataatgtaa

DBGET integrated database retrieval system