KEGG   Francisella tularensis TIGB03: FTU_1565Help
Entry
FTU_1565          CDS       T01762                                 

Gene name
ole1
Definition
Delta-9 fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ftg  Francisella tularensis TIGB03
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    FTU_1565 (ole1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    FTU_1565 (ole1)
Enzymes [BR:ftg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     FTU_1565 (ole1)
Lipid biosynthesis proteins [BR:ftg01004]
 Desaturase
  First
   FTU_1565 (ole1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1688924..1689751
Genome map
AA seq 275 aa AA seqDB search
METQSNKLTIVAFAIMHLACLAIFFVNYNITALVVFVVTFSARTFALTAGYHRYFAHKAF
QTSRVFQFILALVGTWASQKGPLWWSGHHRYHHIHSDKDTDLHSPKNGIFQSHVGWVFES
RSDHVDPKFTKDWVKYPELVWIDKYAHVSFALYLVGLFALGSLISHFYPSLETSGLAFVF
WGGILSTVLLYHTTFSVNSICHIFGSKDYETDNSCNNWFIALITFGEGWHNNHHKFAYSV
RNNLKVWQIDITYMILCVLRKFRIVWDFKQPKKTI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacagtctaataaattgacaatagtagcatttgctattatgcacttagcctgc
ttggcaatattttttgtaaattataatattacagctctagttgtatttgttgttacattc
tcagctagaacatttgctttgacagctggataccatcgttactttgcacacaaagctttt
caaacctctagagtgtttcaatttatcttagcgttagtaggtacttgggcatcgcaaaaa
ggaccgctttggtggtcaggacatcatagatatcatcatatccattctgataaagataca
gacctacactcgcctaaaaatggtatctttcaatcacacgtaggctgggtttttgaatct
agaagtgatcatgttgatcctaaatttactaaagactgggttaagtatcctgagctagta
tggatagataaatatgctcatgtatcatttgctctatatctggtagggctttttgcttta
gggagcctaattagccacttttatccaagccttgaaacatctggactagcatttgtcttc
tggggagggatattaagtaccgtcttactatatcatactacttttagtgtaaactcaatt
tgccatatctttggatctaaagattacgaaacagataatagctgcaacaattggtttata
gctctaattacatttggtgaaggttggcataataatcatcataaatttgcttattcggtt
agaaataatcttaaagtatggcaaatagacattacctatatgattttatgcgtcttgaga
aagttcagaatagtttgggattttaagcaaccgaagaaaactatttag

DBGET integrated database retrieval system