KEGG   Francisella tularensis TIGB03: FTU_1670Help
Entry
FTU_1670          CDS       T01762                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ftg  Francisella tularensis TIGB03
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ftg00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ftg00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1809414..1810334
Genome map
AA seq 306 aa AA seqDB search
MLSFQKLLRGDQITKDDLFKLFHQADIYKNKLANSEPIKDLEGKILASLFFEPSTRTRFS
FESAMNRLGGKVISLENGSSSSTQKGETLDDTGRMIDQYADIIVMRHPKPHSVEEFSKYV
NSPVINAGDGENEHPTQSLVDLYTIYSEKGSLDNLKVGFLGDLKYGRTVHSLTNILAKYN
ASFKFISSKELQIPKKLKDFIIKNGNSFIELDKVSADVLEDLDVLYVTRVQRERFPDEES
YLKNKDLCYLDRKHISPRSNFIILHPLPRVDEMDRSIDELECAKYFEQIKYSIPIRMTLL
ALLVIS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctatcatttcaaaagttactacgcggtgatcaaattactaaagatgatttgtttaaa
ctatttcatcaagctgatatttataaaaataaactagctaattcagagcctatcaaagat
ttagaaggcaaaatattagcatctcttttctttgaaccaagcactagaactagattctct
tttgaatctgctatgaatagacttggtggtaaagtaatatcactagaaaatggctcatca
agctcaacacaaaaaggtgaaacccttgatgatacaggtagaatgattgatcaatatgct
gatattatcgtgatgcgtcaccctaaaccacatagtgttgaagagttctctaaatatgtc
aactctcctgtgataaatgctggcgatggtgaaaatgaacatcccactcagtcattggtt
gacttatatactatctactctgagaaaggctctcttgataatctaaaagttggtttctta
ggagatctaaaatatggtcgtacggttcactcactaaccaatatccttgctaaatataac
gcctcgtttaaatttatatcttcaaaagagctacagattcctaagaaactaaaagatttt
atcatcaaaaatggcaactcttttattgagttagataaagttagtgccgatgttttagaa
gacttagatgtactatatgtaactcgcgtccagagagaaaggtttcctgatgaagaaagc
tatctaaaaaataaagatttatgctatttagatagaaagcatatttcccctagaagtaat
tttataattcttcatcctctacctagagttgatgagatggatagatctattgatgagctt
gagtgtgcgaaatattttgagcaaatcaaatatagtattccgattaggatgacgctattg
gctttattagtaatatcctaa

DBGET integrated database retrieval system