KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_0093Help
Entry
FTH_0093          CDS       T00399                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FTH_0093 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTH_0093 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTH_0093 (trpB)
Enzymes [BR:fth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FTH_0093 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(93757..94947)
Genome map
AA seq 396 aa AA seqDB search
MSKLNAYFGEYGGQFVPQILVPALDQLEQEFIKAQADESFKQEFKELLQEYAGRPTALTK
TRNIVKNTRTKLYLKREDLLHGGAHKTNQVLGQALLVKRMGKKEIIAETGAGQHGVATAL
ACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSANY
SKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQMLAKEGRLPDAVIACVGGGSNAIGMF
ADFIDEKNVKLIGVEPAGKGIETGEHGAPLKHGKTGIFFGMKAPLMQNSDGQIEESYSIS
AGLDFPSVGPQHAHLLAIGRAKYASATDDEALDAFKLLCKKEGIIPALESSHALAHALKL
AYEDPNKEQLLVVNLSGRGDKDIFTVHDILKEKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaactaaatgcttattttggtgagtatggtggtcaatttgtaccacaaatactt
gtcccagctcttgatcaactcgagcaagaatttataaaagcacaagctgatgaatctttt
aagcaagaatttaaagagcttttgcaagagtatgcgggtcgccctactgctcttacaaaa
actagaaatatagtcaaaaacacaagaaccaagctctacctaaaacgcgaggatctacta
catggcggcgctcataaaaccaaccaagtacttggtcaagctctactagtcaagagaatg
ggtaaaaaagagataattgcagaaactggagctgggcaacatggtgttgctactgctttg
gcttgcgcactacttgatctaaaatgtagagtatatatgggtgctaaggatgttgaacgc
caaagccctaatgtctttagaatgaaattaatgggtgctgaagtcatacctgtacatagt
ggctcagctactcttaaagatgcttgtaacgaagcactaagagattggtcagcaaactat
agtaaggctcattacctactaggtactgccgctggacctcatccttttccgacgatagtt
agggaatttcaaagaatgattggtgaagaaaccaaacaacaaatgcttgctaaagaaggt
agactacctgatgctgtgattgcttgtgttggaggtggctcaaatgctattggtatgttt
gctgactttattgatgaaaaaaatgtcaagcttataggtgtagaacctgctggtaaaggt
atcgaaactggtgagcatggagctccgcttaaacatggtaaaactggtatattttttggt
atgaaggcaccactaatgcaaaactcagacggacaaattgaagagtcatactctatatca
gctggtctggattttccatctgttggacctcaacacgctcatttattagcaataggtcgt
gctaaatatgcatctgctacagatgatgaagcgttagatgcttttaaattactctgtaaa
aaagaaggaattatcccagctctagaatcatctcacgccctagcacacgctcttaaactt
gcttatgaggatcctaataaagagcaacttttggttgttaatctatctgggcgtggtgat
aaggatatttttacagtgcatgatattttaaaagaaaagggagagatttaa

DBGET integrated database retrieval system