KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_0218Help
Entry
FTH_0218          CDS       T00399                                 

Gene name
folA
Definition
dihydrofolate reductase type I (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fth00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:fth00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(224173..224715)
Genome map
AA seq 180 aa AA seqDB search
MLKYIKMTKNRFLKMISLIVAYDKNFGIGKENTLAWKLSEDLKNFKKITENNYIVMGRKT
FESIGRPLPNRKNIILTRNKDYKQDKCLIINSTQDILNFAESKPHYEIFIIGGAQIYKEF
LKYADRLYITEVDAEMTDLDAFFPQWDKSKYKRIGHKQFKKNDKNEFDFTFSIFEKNKNL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaatacatcaaaatgactaaaaatagatttctcaaaatgatctcactaatcgtt
gcttatgataaaaactttggtataggtaaagaaaatactctagcatggaaactatcagaa
gatcttaagaactttaaaaaaataacagaaaacaactatattgttatgggtagaaaaacc
tttgaatcgattggtcgcccactaccgaatcgtaaaaatattattttaactagaaacaaa
gattacaaacaagataaatgtttaataataaatagtactcaggatattttaaattttgct
gaatcaaaaccacactacgaaatatttataatcggtggtgcacagatctataaagaattt
ctaaaatacgcagatagattgtatataaccgaagttgatgcagaaatgactgatcttgat
gctttctttccacaatgggataaatcaaaatataaacgtattggtcacaaacaattcaaa
aaaaatgataaaaatgagtttgactttacatttagcatctttgaaaaaaataaaaatttg
taa

DBGET integrated database retrieval system