KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_0441Help
Entry
FTH_0441          CDS       T00399                                 

Definition
hypothetical protein
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(425572..426480)
Genome map
AA seq 302 aa AA seqDB search
MNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTP
QIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQTLKTYIIPFGYNSKEVQLIVE
PNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGKSQRISMLEFSISLERKPTN
ILLKVLIPLTLLVLAMWAIFWMDTKALSDRLNITFIGILSVIAYQFLIEGEILDIDYLTF
TDGFLLLSFSILFSTVLESLAVYWLIKLNKDKLARKMDIFSRFAFPISYLVLITSLYFIY
LH
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaattacaaattgatgtgatttttagatttagctggaatgatcaaagatta
gaatttgataaaaatgaagaaaaaactccatataaattatatcaaggcgactttcaatat
gatgaagtttttgaaggttggaaaccacaaatttctataattaatgaaattggaactcct
caaataaaagctagacaaataaagatttaccctaatggcgatattatatacaccgagcaa
cgtactttacatcttgaaactccaatgcgacttgagaaattcccatttgataagcaaact
ttaaaaacgtatataataccatttggctataattctaaagaggtacaattaatagtcgag
ccaaaccataaaattacagttaaagactatgttaaagatcatccaaatataaatgtagct
gaatggcatctaagtaacttcgatctaaaaaatatagagcctataaaatactactatgga
aaatcacaaagaatatcaatgctagagtttagtatctcattagaaagaaaacctactaat
attcttttaaaagtactgattccattgacattgttagtattagcaatgtgggcaatattt
tggatggatacaaaagctttatcagatagattaaacataacatttataggaattttatct
gtaatcgcatatcaattcttaatcgaaggagaaatacttgatattgactatttaactttt
accgatggatttctactattatctttttctattttattttcaacagttttagaaagttta
gctgtttactggctaataaaattaaacaaagataaactagctagaaagatggatatattc
tcaaggtttgcttttcctattagctacttagttttgataacttctctttattttatctat
ttacattaa

DBGET integrated database retrieval system