KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_0495Help
Entry
FTH_0495          CDS       T00399                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FTH_0495 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTH_0495 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FTH_0495 (thrC)
Enzymes [BR:fth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FTH_0495 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
486545..487837
Genome map
AA seq 430 aa AA seqDB search
MNFISTRDKNIKVSLSEAMQSGLALDGGLFVPERFPTVNWQSFAKDISYAKFAANTLREF
FKGDQLEDSLDKICNNAFTFEAPVRRLDKTTLVLELFHGPTLSFKDFGARFLANCLSSID
SEKPFTILVATSGDTGSAVAAAFHGKSNIRVIVMFPKGKISKRQEKQITCWGDNIQAVEV
EVEGVFDDCQSLVKEAFKTPWWTERTKLNTSNSINIGRLLSQSTYYAYTSWQHYLQTGEK
ANYIVPSGNIGNITAAFWAKQMGFPIGEISMSLNANDTVVDYLETGKFNPKASVETLANA
MDVGNPSNFERLLYLLGNYENFKANVKAICVSDFEIIEEIKQVYRQYHEVVCPHTATGFV
AKNQLDSNKDYIIVATAHPAKFESVIEPILDIQVPPTPALQKLLDKEQNKVVINKSMDEL
CEVYTKAFEA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattagtactagagataaaaatattaaagtttcactaagtgaagcgatgcag
tctggattagctcttgatggaggattatttgtcccagagagatttcctacagttaattgg
cagagttttgctaaagatatcagttacgcgaagtttgctgctaatactctaagagaattc
tttaaaggagatcagctagaagactctttagataaaatttgtaataatgcttttactttt
gaggctcctgtaagaagattagataaaaccacattagttttagagctttttcatggtcca
actttatcttttaaagatttcggtgcgagatttttagcaaactgtttaagctctatcgat
agtgagaagccatttactattttagtggcaacttctggagatacaggttcagcagtagct
gcagcttttcatggtaagagcaatatccgtgttatagtgatgtttcctaaaggtaaaatc
tctaaaagacaagaaaagcagataacttgttggggagataatatccaagcagttgaagtt
gaagttgaaggagtttttgatgactgtcaaagtctagtcaaagaagcttttaagacacct
tggtggacagagaggactaagttaaatacatcaaatagtattaatatcggtagattacta
tcacaatcaacttattatgcttatacatcgtggcaacattatttgcagaccggagagaaa
gcaaactatatagttccatctggcaatattggtaatataactgctgctttttgggcaaag
caaatgggctttccaataggtgaaatatcgatgagtttaaatgctaatgatactgttgtt
gactatctagagactggtaagtttaatcctaaggcaagtgttgaaacgctagcaaatgct
atggatgttggtaaccctagtaattttgaaagattgttatacttgttgggtaattatgaa
aatttcaaagctaatgttaaagctatatgtgtttctgactttgaaattatagaagaaata
aaacaagtgtatcgtcaatatcatgaagttgtttgtccacacacagcaacaggttttgta
gcaaaaaatcagttagatagcaataaagattatataatcgtagcaactgcacatcctgct
aagtttgaaagtgtaattgagcctatattagatatacaagtgccgcctacaccggcgtta
caaaagctactagacaaagagcaaaataaagtagttataaataagtctatggatgagctg
tgcgaggtttatacaaaagcttttgaagcttag

DBGET integrated database retrieval system