KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_0531Help
Entry
FTH_0531          CDS       T00399                                 

Gene name
res
Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Brite
Enzymes [BR:fth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     FTH_0531 (res)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
512125..514998
Genome map
AA seq 957 aa AA seqDB search
MLFEKQQYQEDCVNNIVNILDECDVFNNDYSNLKNIIKEHYKTQRYSQFETSSKKQIDVL
METGTGKTFTYIKTIFEINKQFGKTKFIIVLPRTAIKQGVIQNIKLTDEYFYNEYGKHLK
FIGYTGKDSLSAVQQSFIRNESDLTVLVSTNSAFNKDANTINQAKEDLVEHSSVWEAIAD
KKPIVFIDEPHLLKGGATVEALEKLDSLFIRFGATYPTEEEHKLVNVAYALDSINSFENY
LVKRIAVKNILTGAEESDIKITKINAKGKQSDKSVTFSYSKNQQIYSTTIKIGDDVGSKT
GLDIYHGVTLTKINAKEIFFSNGDTKKVSESYELNDDEIEQMLRVTVSSHFEKEERLFNQ
CIKELSLFFIPSIADFRGDNPRVRKFFEKIYREIRDEYYHNTTNQEYNKYLDKDFKDGKL
QVLEGYFSGDKGDSAKDDDLKKAVDIILNKKEQLLSLDEPLRFVFSVWALQEGWDNPNIF
NICKLATTDKETSRRQQVGRGLRLAVNQAGKRQSFKTLAENENAFYDINTLDMVVSGYEK
DFIEGIQSEIQKASFGIVGDFLENSLLEANGLNLREISKLINTLEDNQIIEFDESIEKYK
IISSIYDFIENNADKLSFLSNDRLQEIKQLFKSRKSLIEDKNKTIEKLKIRQEQAKKFKE
LWETINRKAEIVYKDINELDIINKIADAFDTENFSQIDTKVITKVYDPIKDKVVTKEEQS
LGKIDFFAKNKLSEFVFEFSKKEKLPLGFVTKLFSKLDLQKIKNNPSKAINFIKTQIKES
IHTSILQCVDYDFSQTNIFSKNILQNDDGSFIKEIEYTKLGRNIGDEASDEFLFDRVVYD
SDIEKQAILNDPISIDGQQITVFAKLPSISMPTPYKSYNPDFAYLVDRGENQKQLFLVVE
TKSYKNNSDIPQAEKTKIDYAKKFFEGLQKQLPDVEIRFKTRVNKQELSNILQEYQK
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgctatttgaaaaacaacagtatcaagaagattgtgtaaataatatcgtaaatatttta
gatgagtgcgatgtctttaataatgactattcaaatctaaaaaatataatcaaagaacat
tataaaactcaaagatacagccagtttgaaacatccagtaagaagcaaatagatgtttta
atggaaactggtacaggtaaaacatttacctatataaaaactatttttgagataaacaag
caatttggcaagactaaatttattatagtgctacctcgtacagccattaaacaaggtgtt
attcaaaatatcaaacttactgatgaatatttctataatgagtatggtaagcatttaaag
tttataggctatacaggtaaagatagtttatcagcagtacagcaaagttttattcgtaat
gaatcagatttaacagttcttgtgtctaccaattcagcatttaataaggatgctaataca
attaaccaagctaaagaagatcttgttgagcatagtagtgtatgggaagcaatagcagat
aaaaagccaatagtgtttatagatgagccacatttattaaaaggtggtgccacagttgaa
gctttagaaaagttggatagcttatttattcgttttggtgctacataccctacagaagag
gagcataagcttgtaaatgttgcttatgctttagatagtattaactcatttgaaaactat
ttagtaaaaagaattgcagttaagaatattctaacaggtgcggaagagtcagatattaaa
atcacaaagataaatgcaaaaggtaagcaatccgataaatctgtaacatttagttattca
aaaaatcaacaaatatactcaactactatcaaaattggtgatgatgtaggctctaaaact
ggtttagatatttatcatggtgtaacgcttaccaaaataaatgcaaaagaaatatttttc
tctaatggagatactaaaaaagttagtgaaagctatgagttaaatgatgatgagattgag
caaatgcttagggttacagtttctagtcattttgaaaaagaagaaagactttttaatcaa
tgtattaaagagttatcactattttttattcctagtattgcagattttaggggagataat
cctagagttagaaaattttttgagaaaatatatcgtgagattcgtgatgagtattatcac
aacacgactaatcaagagtataataaatatctagataaagactttaaagatggcaaacta
caagttttagaagggtacttctcaggtgataagggtgatagtgcaaaagatgatgatcta
aaaaaagcagtggatattattcttaataaaaaagaacaattattatcgcttgatgaacct
ttaagatttgttttctcagtatgggctttgcaagagggttgggataaccctaacattttt
aatatttgtaaacttgcaactacggataaagaaacatctagaagacagcaagtaggacgt
ggacttagattagctgttaatcaggcaggaaaaagacagtcatttaaaaccttggcagaa
aatgaaaatgctttttatgatattaatacccttgatatggtggtttcaggctatgaaaaa
gactttatcgaaggtatccaatcagaaattcaaaaagctagctttggtattgttggagac
ttcttagaaaatagcttattagaagcaaatggactaaatttaagagaaattagcaaatta
ataaataccttagaagataatcaaattattgaatttgatgagtcgattgagaagtataaa
attattagcagcatttatgattttatagaaaataatgctgataaattatctttcttatct
aatgataggttgcaagaaataaaacaactgtttaagtctagaaaatctcttattgaagat
aaaaataaaacaatagaaaagttaaaaattcgccaagaacaagctaagaaattcaaggag
ctatgggagactattaatcgcaaagcagaaatagtttataaagatataaatgagctagat
attatcaacaaaatagcagatgcttttgatacagaaaacttttctcagatagatacaaag
gttataacaaaagtttatgatcctataaaagacaaggttgttaccaaagaagagcaatct
ctaggtaaaattgatttctttgctaaaaataaacttagtgaatttgtatttgagttctct
aaaaaagaaaaacttcctctagggtttgttacaaaattattcagtaagcttgatttgcaa
aagataaaaaacaatccaagtaaagctattaactttataaaaacacaaataaaagagtct
attcatacgagtattttacaatgtgttgattatgattttagccaaacaaatatatttagt
aaaaatattttgcaaaatgatgatggtagttttatcaaagaaattgaatacactaaacta
ggtagaaatattggagatgaggcgtctgatgagtttttatttgatcgagttgtttatgat
tcagacatagaaaaacaggcaatattgaatgatcctatttcaatagatggtcagcaaata
acagtttttgcaaaactaccaagtatatctatgccaacaccatacaaatcatataatcca
gattttgcttaccttgttgatagaggcgaaaaccaaaagcaattatttttagtggttgaa
actaaaagctataaaaataatagtgatatccctcaagctgaaaaaacaaaaatagattat
gctaaaaagttctttgaaggtttgcagaagcaattacctgatgttgaaattagatttaaa
accagggtaaataaacaggaattgtctaatattttacaggagtaccaaaaatga

DBGET integrated database retrieval system