KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_0536Help
Entry
FTH_0536          CDS       T00399                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
  KO
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fth00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FTH_0536 (dxr)
Enzymes [BR:fth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     FTH_0536 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
520225..521385
Genome map
AA seq 386 aa AA seqDB search
MFKKTKITILGATGSIGDSTLAVIRETNDFEVFALTAFSNVEKLAELCQEFKPKFAVVPD
LSKKQKLQSLVTDVEVLVGESGLEKVSSLAEIDIVMSAIVGIAGLKPTFAAAKAGKKILL
ANKESLVTAGHLLIDEVVKNNAQLIPVDSEHNAIFQCIDNHDKKCLPEIDKIILTASGGP
FRDKQQLHELTDVTPEQACNHPNWQMGRKISVDSSTMVNKALEVIEAYWLFSVSADKIGV
LIHPQSVTHSIVRYVDGSYIAQLGVPDMKTPIANAMYYPKRGSVNVESLDFTKYQLTFRE
ACFERFEALKIVFNNLQNKNYAANIVFNAANEELVAAFLNKKIKYLEIIEVNKKVTKELN
FENPKNIEEVFEIDRKTREYVDSVLG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaactaagattactatattaggagctacaggatctataggtgatagcact
ttagctgttattagagagactaatgattttgaagtttttgcattaactgcatttagtaat
gttgaaaagctggcagagctatgtcaagagtttaagcctaaatttgctgtagttccagac
ttgtcaaaaaaacaaaagttacaatcattagttactgatgttgaggttttggttggtgaa
agtgggcttgaaaaagtatctagcttagctgaaattgatattgtcatgtctgctatagtt
ggtatagcagggttaaaaccaacctttgcagcagctaaagctggtaagaaaattttgctt
gctaataaagaatctttggtaacagcaggacacttgctgatagatgaggttgtaaagaat
aatgctcaacttattcctgtggatagtgaacataatgctatatttcagtgtattgataat
catgataagaagtgtttgccagagattgataagataattttaacagcatctggaggtcct
tttagagacaaacaacaactacatgagttaacggatgtaacacccgagcaagcatgcaat
catcctaattggcaaatgggcagaaaaatatcggttgattcatcaactatggtaaataaa
gcgttagaagttatcgaagcgtattggcttttttctgtttcagctgataaaataggcgtt
ctgattcatccacagagtgtaactcattctattgtcagatatgttgatggtagctatata
gcgcagttaggtgtgcctgatatgaaaacacctatagccaacgcaatgtactatccaaag
agaggatcagttaacgttgagagcttagattttacaaaatatcagctaaccttcagagaa
gcttgttttgaaagatttgaagctttgaaaatagtttttaataatttacaaaataaaaat
tatgctgctaacatagtttttaatgctgctaatgaggagcttgtggctgcatttttaaac
aaaaaaattaaatatttagagataatagaagtaaacaaaaaagtaacaaaagagttaaat
tttgagaatccaaaaaatatagaagaagtttttgaaatagatagaaaaactcgtgaatat
gtggattctgttttggggtaa

DBGET integrated database retrieval system